KEGG   Ehrlichia ruminantium Welgevonden (France): ERWE_CDS_08470
Entry
ERWE_CDS_08470    CDS       T00233                                 
Name
(GenBank) Hypothetical protein
Organism
erw  Ehrlichia ruminantium Welgevonden (France)
SSDB
Motif
Pfam: TrbC
Other DBs
NCBI-ProteinID: CAI27341
UniProt: A0A0H3M0S6
Position
complement(1361676..1362038)
AA seq 120 aa
MCMLRILLVFLMIIGLMGNVSTAAADSNANDDTGVTKVMCNVISFVQKLGLPIMTGVILG
SSIMAIFGKLPWPAIVMLVVFTAIFFGAGKLMTKFAGGVNGTQTGEVCPNNGGGQNQLVK
NT seq 363 nt   +upstreamnt  +downstreamnt
gtgtgtatgcttagaatattgttagtatttttgatgattatagggttaatgggtaatgta
tctactgctgctgcggatagtaatgctaatgatgatactggtgtaactaaagttatgtgt
aatgttataagttttgtacaaaaattgggtttgccaattatgacaggagtgatattaggt
tcaagtataatggcaatattcggtaagttaccatggccagcaatagtgatgcttgttgta
tttacagcgatattttttggtgctggtaaattaatgactaaatttgcaggtggagtaaat
ggtactcagacaggagaagtttgtcctaataatgggggggggcaaaaccagttagttaaa
tga

DBGET integrated database retrieval system