KEGG   Erythrobacter sp. s21-N3: CP97_09480Help
Entry
CP97_09480        CDS       T03997                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ery  Erythrobacter sp. s21-N3
Pathway
ery00071  Fatty acid degradation
ery00072  Synthesis and degradation of ketone bodies
ery00280  Valine, leucine and isoleucine degradation
ery00310  Lysine degradation
ery00362  Benzoate degradation
ery00380  Tryptophan metabolism
ery00620  Pyruvate metabolism
ery00630  Glyoxylate and dicarboxylate metabolism
ery00640  Propanoate metabolism
ery00650  Butanoate metabolism
ery00900  Terpenoid backbone biosynthesis
ery01100  Metabolic pathways
ery01110  Biosynthesis of secondary metabolites
ery01120  Microbial metabolism in diverse environments
ery01130  Biosynthesis of antibiotics
ery01200  Carbon metabolism
ery01212  Fatty acid metabolism
ery02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ery00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CP97_09480
   00630 Glyoxylate and dicarboxylate metabolism
    CP97_09480
   00640 Propanoate metabolism
    CP97_09480
   00650 Butanoate metabolism
    CP97_09480
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CP97_09480
   00072 Synthesis and degradation of ketone bodies
    CP97_09480
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CP97_09480
   00310 Lysine degradation
    CP97_09480
   00380 Tryptophan metabolism
    CP97_09480
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CP97_09480
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CP97_09480
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CP97_09480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ery04147]
    CP97_09480
Enzymes [BR:ery01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CP97_09480
Exosome [BR:ery04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CP97_09480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417
Motif
Other DBs
NCBI-ProteinID: AKQ43344
UniProt: A0A0H4VK16
Position
complement(1957865..1959121)
Genome map
AA seq 418 aa AA seqDB search
MRGVLQLESRYTHIQRTKLHMPKFNESDPVVILSYARTPMGAMQGALADVAATDLGATAV
KAAIERAGVAGEDVDRVYMGCVLPAGLGQAPARQVAIKSGLPLSAQATTVNKVCGSGMQT
VIMGAEALATGTIDTIVAGGMESMTNAPYLLKKHRSGARIGHDTAYDHMFLDGLEDAYEE
GRAMGTFAQEMADKYQLTREQMDNYSITSLERANAAINSGAFADELVPVTYSTRRGDVTV
DTDESPSKGRPDKIPTLRPAFAKDGTITAATSSSISDGAAAVVLTRKSVADAKGLTPVAT
IIGLTAHAQAPEEFTIAPVGAIEKLLEQTGWSVDDVDLWEVNEAFACVTMFAMQDIGISH
DKININGGGTALGHPIGASGTRIIVTLLNALKQQGKKRGIASLCIGGGEATAVAVELA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcggcgtattgcaattggaaagtcgatatacccacatccagaggaccaagcttcat
atgcctaagttcaacgaatccgatcccgtcgtcatcctttcttatgcgcgcaccccgatg
ggcgcgatgcagggcgcattggctgacgttgctgcaaccgatctgggtgcaacagctgtt
aaggccgcgatcgaacgtgctggcgttgctggcgaagacgttgatcgtgtttacatgggc
tgtgtacttcccgccggccttggtcaggccccggcgcgccaggtggcgataaaatcaggt
ctgccgctcagtgcgcaggcgaccacggtcaacaaggtttgcggcagtggtatgcaaacc
gtcatcatgggggcagaggcgctggcaaccggcacgatcgatacgatcgttgcgggcggc
atggaaagcatgaccaacgccccatacttgctcaagaagcatcgctctggcgcgcgtatc
ggacatgatacagcttatgaccacatgttcctcgacgggctggaagatgcctatgaagaa
ggccgcgccatgggcactttcgcgcaggagatggctgacaaatatcagctgacccgcgag
cagatggataattactccatcacttccctcgaacgcgccaatgcagcgattaatagtgga
gcgttcgctgatgagctggttccggtaacttattccacacgtcgtggcgatgtgacagtc
gatacggatgaatcgccgtctaaaggccgaccagacaagatcccgacgctacgtcccgct
ttcgccaaggatggcacgataaccgctgcgacgtcgtcctctatctccgatggcgctgcg
gctgtagtgctgacgcgcaaaagcgtggctgatgcaaagggtcttacgcctgtcgcgacc
atcattggcctcactgcacatgctcaggcccctgaagaattcaccatcgcccctgtcggt
gcgatcgagaagctactcgaacagaccggctggagcgtggatgatgtggatttgtgggaa
gtgaatgaagcatttgcctgcgtcaccatgttcgccatgcaggacatcggcatctcgcat
gacaagatcaatatcaatggcggcggcaccgcactgggccacccgatcggtgccagcgga
acacgcatcatcgtaacgcttctcaatgcgctgaaacagcagggaaagaaacgcggcatc
gcttcattgtgcatcggcggcggtgaagcaacggccgtagccgtcgaactggcctga

DBGET integrated database retrieval system