KEGG   Aurantiacibacter atlanticus: CP97_14265
Entry
CP97_14265        CDS       T03997                                 

Definition
(GenBank) 1,2-dihydroxybenzylpyruvate aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
ery  Aurantiacibacter atlanticus
Pathway
ery00626  Naphthalene degradation
ery01100  Metabolic pathways
ery01120  Microbial metabolism in diverse environments
ery01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ery00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CP97_14265
Enzymes [BR:ery01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     CP97_14265
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: AKQ42951
UniProt: A0A0H4VJ90
Position
2920068..2921054
AA seq 328 aa
MSRELLTADDVKGAWAIVPTPAKQGASDWRATNTVDVDETARMVDGLIKAGVDGILSMGT
LGEAATMTYDEKLVFMQTLVDTAAGRVPVFVGTTCINTRDTVALTRKAVDIGATGTMLGI
PMWCAPSVDVAVQFYKDVSEAVPDINVAIYANPEAFKFDFPRNFWAQVAEIPQVVTAKYI
GVATLLPDLAAIKGRIKLLPIDFDYYGAARMDDSINAFWTSGAVCHPLVSTTLRDLVAQA
RESGDWSQAKAFMGRLGPTAATLFPNGSFKEFSTYNIALEKARMTAGGWMDAGPCRPPYH
LCPEPYLEGARKSGRMWAELGKALENEA
NT seq 987 nt   +upstreamnt  +downstreamnt
gtgtcgcgtgaacttctgactgcagatgatgtcaagggtgcttgggctattgttccaaca
ccggcgaagcagggcgcctccgactggagagctacgaatactgtcgatgtcgatgagact
gcccgtatggttgatggcttgatcaaggccggggtcgatgggatcctgagcatgggtacg
cttggtgaagccgcgaccatgacttacgatgaaaagctcgttttcatgcagacattggta
gataccgctgccggcagggtgccggttttcgtcggaacgacctgtattaatactcgcgac
accgtggccttaactcgtaaagctgttgatatcggtgccaccgggaccatgcttggtatt
cccatgtggtgtgcgcccagcgtcgatgtggcagtccaattctataaggacgtcagcgag
gcggttcctgatatcaacgtcgctatctatgctaatccagaagcgttcaaatttgatttc
ccgcggaatttctgggctcaggtcgcggaaattccccaggttgtcacggcgaagtatatc
ggtgtcgcaacgcttctacccgatcttgcagcaatcaagggtcggatcaaattgttgccg
atcgactttgattattatggcgcggcgcgcatggacgattcaatcaacgcgttttggaca
agcggtgcggtatgtcacccattggtcagtacgactctgcgcgatctggtcgcccaagca
cgcgaaagcggcgattggagccaggctaaggcgttcatgggccgcctaggccccaccgcc
gccaccctatttccgaacggaagcttcaaggagttttcgacctataatattgctctggaa
aaagcgcggatgacagcaggtggctggatggatgctggcccttgccgcccgccctatcac
ttatgtccggagccttacctggaaggcgctcgcaaatcggggcgtatgtgggcggaactg
ggcaaggcactcgaaaacgaggcctga

DBGET integrated database retrieval system