KEGG   Egibacter rhizosphaerae: ER308_01635Help
Entry
ER308_01635       CDS       T05860                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
erz  Egibacter rhizosphaerae
Pathway
erz00625  Chloroalkane and chloroalkene degradation
erz00680  Methane metabolism
erz01100  Metabolic pathways
erz01120  Microbial metabolism in diverse environments
erz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:erz00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ER308_01635
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ER308_01635
Enzymes [BR:erz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     ER308_01635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C HI0933_like AlaDh_PNT_C FAD_binding_2 ADH_zinc_N_2 FAD_binding_3 Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: QBI18399
UniProt: A0A411YB41
Position
complement(363809..364945)
Genome map
AA seq 378 aa AA seqDB search
MKAVVYQEPFEVAVEEVEDARIEASTDVVVRITSTAICGSDLHMYEGRTDAEPGIVFGHE
NMGVVEEVGSGVASLRKGDRVVLPFNVACGFCENCEARQTAFCLTVNPGYAGGAYGYVGM
GPYPGGQAEYLRVPFADFNALKLPPGDDHEADFAMLADIFPTGYHATEMAEVKPGDTVAV
YGAGPVGLMAAYSAQLRGAERVFVVDKVANRLELAEQQIGAIPVNFAEVDPVEYIVDQTD
GLGSDKGIDAVGYQATVSDSNEEQPAVVLNQLVGTVRHTGLIGTVGLYLSSDPGAPSDEA
KHGRLLLEMGRFFEKGLRMGTGQANSKNYNRELRDLIIAGRARPSFVVSKQLPLDEAPDA
YHRFDQREEGYSKVVLQP
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtcgtctatcaggagccgttcgaggtcgccgtcgaggaggtcgaggacgcc
cgcatcgaggcgtcgaccgacgtggtggtgcgcatcacctccacggcgatctgcggctcc
gacctgcacatgtacgagggccgcaccgacgccgagcccggcatcgtgttcggccacgag
aacatgggcgtcgtcgaggaggtggggtcgggggtcgcgtcgctgcggaagggcgatcgc
gtcgtcctgccgttcaacgtggcgtgcgggttctgcgagaactgcgaagcccggcagacc
gccttttgtctcaccgtgaacccgggctacgccgggggcgcctacgggtacgtgggcatg
gggccctatccggggggacaggccgagtacctgcgcgtgccgttcgcggacttcaacgcg
ctcaagctcccgcccggcgacgaccacgaggccgacttcgcgatgctggccgacatcttc
ccgaccggctaccacgcgaccgagatggccgaggtcaagccgggcgacaccgtcgcggtc
tacggcgccggccccgtcggcctcatggccgcctactccgcgcagctgcgcggcgccgag
cgggtcttcgtcgtcgacaaggtggccaaccggctcgagttggcggagcagcagatcggg
gcgatcccggtgaacttcgccgaggtcgaccccgtcgagtacatcgttgaccagaccgac
gggctcggcagcgacaagggcatcgacgcggtcggctaccaggcgaccgtgtccgacagc
aacgaggaacagccggccgtcgtgctgaaccagctcgtgggcaccgttcggcacaccggc
ctgatcgggacggtcggcctgtacctctcgtcggacccgggggcgccgtcggacgaggcc
aagcacgggcgtctcttgctcgagatggggcggttcttcgagaaggggctgcgcatgggc
accggccaggccaacagcaagaactacaaccgagagctgcgcgatctcatcatcgccggc
cgcgcccggcccagcttcgtggtctccaagcagctgccgctggacgaggcacccgacgcc
taccaccggttcgaccagcgcgaggagggctacagcaaggtggtgctccagccctga

DBGET integrated database retrieval system