KEGG   Egibacter rhizosphaerae: ER308_15805Help
Entry
ER308_15805       CDS       T05860                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
erz  Egibacter rhizosphaerae
Pathway
erz00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:erz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ER308_15805
Enzymes [BR:erz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ER308_15805
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ER308_15805
    1.1.1.-  
     ER308_15805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C NAD_binding_2 adh_short 3HCDH_N AlaDh_PNT_C Shikimate_DH ApbA ThiF Sacchrp_dh_NADP NAD_binding_7 TrkA_N 2-Hacid_dh_C F420_oxidored Pyr_redox
Motif
Other DBs
NCBI-ProteinID: QBI20893
UniProt: A0A411YI52
Position
3431161..3432297
Genome map
AA seq 378 aa AA seqDB search
MAENASATMRAAIYHGPRDIRIEDVPAPSPGSGELLVEVGVAGICGTDAHEYAAGPVMFP
IDREHPVTGHRGPLIPGHEFAGRVVGVGDGGDPAWMGCDVAVGGGYGCEACRYCRERRPN
LCADYAAVGLHRHGGLAQYAAVPGIACEDASTFDLPADFAALGQPAAIAMHALRRGRVDP
GEHVAVVGVGGIGAFLVPALVRAGARVSVFDRDRERLAIADELGAHELLEVRANDDIGER
IRELPATPDAVFEITGVGPVLDAILRAAVPGVRIVVVGLHDGQAAVAFRPISLREQELLG
TNALVREVDLPAALDLLAQPDLAWDRVAPVVLGLDELVEDGLEPLASGRAQRIKTLIDPW
ARERRAFGATPTTRKAAA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacgcctccgccacgatgcgcgcggcgatctaccacggaccccgcgatatc
cgcatcgaggatgtcccggcgccgagccccggttcgggtgagctgctcgtcgaggtcggg
gtcgccggcatctgcggcaccgatgcgcacgagtacgcagccgggccggtgatgttcccg
atcgaccgcgaacaccccgtcaccggtcaccgtggtccgctgatccctggccacgagttc
gctggacgggtcgtgggcgtcggagacgggggcgacccggcctggatggggtgcgacgtc
gcggtcggaggcggctacggatgcgaggcttgccgctattgccgcgagcgacgcccgaac
ctctgcgcggactacgcagccgtcgggttgcaccgccacggtggattggcccagtacgcc
gcggtgccaggcatcgcgtgcgaagacgcgagcacgttcgacctgcccgccgacttcgcc
gcgctcgggcagccggccgcgatcgcgatgcacgctctgcgccgtggccgggtcgacccg
ggtgagcacgtcgcggtcgtgggtgtcggtggcattggggcgttcctcgtccccgccctc
gtgcgggccggcgctcgggtgagcgtgttcgaccgggaccgcgaacgcctcgcgatcgcc
gatgaactgggcgcgcacgagttgctcgaggtccgcgcgaacgacgacatcggggagcgg
atccgtgagctgccggccacacccgacgccgtgttcgagatcaccggcgtcggccccgta
ctcgacgcgatcctgcgcgcagccgtccccggcgttcggatcgtcgtggtcgggctgcac
gacggacaggcggccgtggcgttccgtccgatctccctgcgcgaacaggagctgctcggg
accaacgcgctcgtgcgcgaggtcgacctgccagctgcgctcgacctcctggcccagccc
gatctcgcctgggaccgcgtcgccccggtcgtgctcggactcgacgagctggtcgaggac
ggcctcgagcccctggccagtgggcgggcgcagcggatcaagaccctcatcgatccctgg
gcgcgtgagcgccgcgcgttcggcgcgacgccgacgacacgaaaggcagccgcatga

DBGET integrated database retrieval system