KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_00447Help
Entry
ESA_00447         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00071  Fatty acid degradation
esa00280  Valine, leucine and isoleucine degradation
esa00310  Lysine degradation
esa00362  Benzoate degradation
esa00380  Tryptophan metabolism
esa00620  Pyruvate metabolism
esa00630  Glyoxylate and dicarboxylate metabolism
esa00640  Propanoate metabolism
esa00650  Butanoate metabolism
esa00900  Terpenoid backbone biosynthesis
esa01100  Metabolic pathways
esa01110  Biosynthesis of secondary metabolites
esa01120  Microbial metabolism in diverse environments
esa01130  Biosynthesis of antibiotics
esa01200  Carbon metabolism
esa01212  Fatty acid metabolism
esa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:esa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ESA_00447
   00630 Glyoxylate and dicarboxylate metabolism
    ESA_00447
   00640 Propanoate metabolism
    ESA_00447
   00650 Butanoate metabolism
    ESA_00447
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ESA_00447
   00072 Synthesis and degradation of ketone bodies
    ESA_00447
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ESA_00447
   00310 Lysine degradation
    ESA_00447
   00380 Tryptophan metabolism
    ESA_00447
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ESA_00447
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ESA_00447
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ESA_00447
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:esa04147]
    ESA_00447
Enzymes [BR:esa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ESA_00447
Exosome [BR:esa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ESA_00447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF840
Motif
Other DBs
NCBI-ProteinID: ABU75743
UniProt: A7MR69
Position
421998..423176
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGAARTPIGCFQGQLARRSAVELGAVVIEALLTRTGLNPQDVDEVILGQVLTAG
AGQNPARQTALNSGLPWSVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTEGRTGGPGDSHIIDSLVHDGLWDAFNDYHMGVTAENLAREYNISREHQDAYALA
SQHKARVAIDSGRFRDEIVPVVIEQMQGAPLVVDTDEQPRADTSAEGLARLSPAFDRLGS
VTAGNASSMNDGAAAVLMMSASKAQEMGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLNDVDLIEANEAFAAQTLSVGKLLAWDERKVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRQARKGLATLCIGGGQGVALAIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtggtaattgtcggggctgctcgcacgcccattggctgctttcagggccag
cttgcgcgtcgctcggcggtcgagctcggcgcggtggtcattgaggcactgctgacgcgc
accgggcttaaccctcaggatgtcgatgaagttatcctgggccaggtgctgacggcaggc
gcaggccagaatccggcgcggcagactgcgctcaacagcggcctgccgtggtcggtttcg
gcgattaccatcaatgatgtgtgcggctctggcctgaaggcgctgcatctggcgacgcag
gcgatccagtgcggtgaggcggatgtggtgattgctggcggtcaggaaaatatgagccgc
gcgccgcatgtgctgaccgaagggcgcaccggcgggcccggcgacagccatattatcgac
agcctggtgcatgatgggttgtgggatgcgtttaacgattaccatatgggcgtcacggcg
gaaaatctggcgcgcgaatataacatcagccgtgaacatcaggatgcttacgcgcttgca
tcacagcataaagcgcgggtcgctatcgacagcggacgctttcgtgacgaaatcgtgccc
gtcgtgatcgaacagatgcagggcgcgccgctggtggtcgataccgacgagcagccacgc
gccgataccagcgcggaagggctggcgcgcctgtcgcccgcctttgaccggctgggaagc
gttaccgcgggcaacgcctcgtcaatgaatgatggcgcggcggcggtgctgatgatgagc
gccagcaaggcgcaggaaatggggctgccggtgctcgcgcgcatacgcgctttcgcaagc
gtgggcgtcgatccggctctgatgggcatcgcgccggtctacgctacgcgccgctgtctg
gagcgcgcgggctggcagctcaatgatgttgatcttatcgaggccaatgaggcgttcgcg
gcacagacgctatcggtcggcaaactgcttgcgtgggacgagcgcaaggtgaacgttaac
ggcggtgcgattgccctgggacatccgattggcgcgtccggctgccgcattctggtttct
ctggtccatgagatggtgaaacgtcaggctcgcaaagggctcgccacgctttgcattggt
ggcggccagggcgtggcgttggcgattgaacgcgattaa

DBGET integrated database retrieval system