KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_00515Help
Entry
ESA_00515         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Brite
KEGG Orthology (KO) [BR:esa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:esa03016]
    ESA_00515
Enzymes [BR:esa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     ESA_00515
Transfer RNA biogenesis [BR:esa03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    ESA_00515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ABU75806
UniProt: A7MQZ5
Position
487991..488788
Genome map
AA seq 265 aa AA seqDB search
MSLEILYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSG
VLLMGLSSEAGRRLAQQFEQHQIQKRYHAIVRGWLTDSAVLDYPLVEELDKIADKFSRQD
KEPQPAVTHYRGLATTSQPVAVGRYDSVRYSLVEMLPQTGRKHQLRRHMAHLRHPIIGDS
KHGDLRQNRAAAEHFGCNRLMLHASELTLTHPFTGAPFTIRAGLDDVWRQALAHFGWQTH
LPAADGVEFPAVNPHDEDSLNPEGE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctcgaaatcctttatcaggatgaatggctggtggcggtcaataagccgtccggc
tggctggtccaccgcagctggctcgatcgcgatgaaaaagtcgtcgtcatgcagacggtt
cgcgatcagattggccagcacgtttttaccgctcaccgtctcgacaggcccacatccggc
gtgttgttgatgggcctttccagcgaggcgggaaggcggttagcgcagcagtttgaacag
catcagatccagaaacgctaccacgctatcgtgcgcggctggctcaccgacagcgccgtg
ctggattatccgctggtggaagagcttgataaaatcgccgataaattctcacggcaggat
aaggaaccgcagccagccgtaacgcactatcgcggccttgcgaccacctcgcagccggtc
gccgtcgggcgttatgattcagtgcgctacagcctggtggagatgctgccgcagaccggc
cgtaaacatcagctgcgccgccatatggcgcatctgcgccacccgattatcggtgactca
aagcatggcgatttgcgccagaaccgcgcagcggccgagcatttcggctgtaaccgcttg
atgcttcacgccagcgagctgacgctgacgcacccgtttaccggcgcgccgttcactatc
cgcgcaggtctggatgacgtctggcgtcaggcgctggcgcattttggctggcagacgcat
ctccccgctgccgatggggttgagtttcccgctgtgaaccctcacgatgaagacagtctg
aatccagaaggagagtaa

DBGET integrated database retrieval system