KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_00882Help
Entry
ESA_00882         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00071  Fatty acid degradation
esa00280  Valine, leucine and isoleucine degradation
esa00281  Geraniol degradation
esa00310  Lysine degradation
esa00362  Benzoate degradation
esa00380  Tryptophan metabolism
esa00410  beta-Alanine metabolism
esa00640  Propanoate metabolism
esa00650  Butanoate metabolism
esa00903  Limonene and pinene degradation
esa00930  Caprolactam degradation
esa01040  Biosynthesis of unsaturated fatty acids
esa01100  Metabolic pathways
esa01110  Biosynthesis of secondary metabolites
esa01120  Microbial metabolism in diverse environments
esa01130  Biosynthesis of antibiotics
esa01200  Carbon metabolism
esa01212  Fatty acid metabolism
Module
esa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ESA_00882
   00650 Butanoate metabolism
    ESA_00882
  Lipid metabolism
   00071 Fatty acid degradation
    ESA_00882
   01040 Biosynthesis of unsaturated fatty acids
    ESA_00882
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ESA_00882
   00310 Lysine degradation
    ESA_00882
   00380 Tryptophan metabolism
    ESA_00882
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ESA_00882
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ESA_00882
   00281 Geraniol degradation
    ESA_00882
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ESA_00882
   00930 Caprolactam degradation
    ESA_00882
Enzymes [BR:esa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ESA_00882
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ESA_00882
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ESA_00882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABU76152
UniProt: A7MH81
Position
849786..851939
Genome map
AA seq 717 aa AA seqDB search
MESTSAFNLQMRPDNVAVVTIDVPGEKMNTLKAEFARDVRAIVKTLRENRDLAGVVFISA
KPDNFIAGADINMIAHCQSAQEAEALASQGQQIMAEIRALPVHVVAAIHGACLGGGLELA
LACHSRICTDDVKTLLGLPEVQLGLLPGSGGTQRLPRLVGVSTALEMILAGKQLRPRQAL
KAGLVDDVVPQSILLEAAAELAKKRRPAPRRLPVRERLLAGPIGRALLFRMVTQKTHQKT
HGNYPAAQRIIDVVRTGLEQGSASGYQAEARAFGELAMTPESAALRGLFFATTELKKETG
SEAAPRALHSVGVLGGGLMGGGIAYVTATKARLPVRIKDISEKGINHALKYSWDLLEKKV
RRRHLRASERDAQMALISASTDYRGFHQRDIVVEAVFEDLTLKQNMVAEIEAHTAPHTIF
ASNTSSLPIGDIAAGATRPEQVIGLHYFSPVDKMPLVEVIPHAGTSAETIATTVQLAKKQ
GKTPIVVADCAGFYVNRILAPYINEAMRCLMEGESIEKIDEALVKRGFPVGPIQLLDEVG
IDVGTKIMPVLERAYGPRFSAPGDAVAAILNDDRKGRKNGRGFYLYPAKGRKSKKQVDPA
VYGLIGVKPGGKLSGEEIAERCVMMMLNEAARCLDEGVVRSARDGDIGAVFGIGFPPFLG
GPFRYMDTLGAAAMATTLTRLATRYGDRFTPCDRLLRMAQTGQTFWLAGNLQAEMTV
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgacatccgcatttaatttacagatgcgcccggacaatgttgcggtggtcacc
atcgacgtgccgggcgagaaaatgaacacgctgaaggcggagtttgcccgcgacgtccgc
gcgattgtcaaaacgctgcgggaaaaccgcgatctcgcgggcgtggtatttatctccgcc
aagccggataactttatcgccggtgcggatatcaacatgatcgcgcactgccagagcgcg
caggaggccgaagcgctggcaagccagggccagcagatcatggcggagatccgcgcgctg
ccggtgcatgtggtcgcggccattcatggcgcgtgccttggcggcgggctggagctggcg
cttgcctgccacagccgcatctgtaccgatgatgtgaaaacgctgctcgggctgccggaa
gtgcagcttgggctgctgccgggctccggcggcacgcagcggttgccgcgcctcgttggc
gttagcaccgcgcttgagatgatccttgcgggcaaacagctgaggccgcgtcaggcgctg
aaagccgggctggtggatgatgtggtgccgcaatctattttgctggaagccgctgccgaa
ctggcgaaaaagcgccgtcccgcgccgcgccgtctgccggttcgcgagcgtttgctcgca
ggcccgattggccgcgcgctgctgtttcgcatggtgacgcagaaaacgcaccagaaaacc
cacggtaactatccggcggcgcagcgcattattgacgtggtgcgcaccggccttgagcag
ggcagtgccagcggttaccaggctgaggcccgcgcctttggcgagctggcgatgacgccg
gaatctgccgcgctgcgagggctgttcttcgccaccaccgagcttaaaaaagagaccggc
agcgaggccgccccgcgcgcgctgcactcggtcggtgtactgggcggcgggctgatgggc
ggcgggattgcgtatgtcaccgccaccaaagcccggttgccggtacgtatcaaagacatc
agcgaaaaaggcattaaccatgccctgaaatacagctgggatctgcttgagaaaaaagtg
cgtcgtcgtcatctgcgcgccagcgagcgcgacgctcaaatggcgctcatctccgccagc
accgattaccgtggatttcaccagcgcgatatcgtcgtggaagcggttttcgaagattta
acgcttaagcaaaacatggtggcagagatcgaggcgcataccgcgccgcatacgattttc
gcgtctaatacctcgtcgctgcctatcggcgatatcgccgcaggcgctacgcgcccggag
caggtgattggcctacactacttcagcccggtggataaaatgccgctggtggaagttatc
ccgcacgcgggcaccagcgcggaaaccattgccaccaccgttcagcttgccaaaaaacag
ggcaaaacgccgatcgtggtggccgactgcgccgggttttatgttaaccgcattctcgct
ccctacatcaatgaggcgatgcgctgcctgatggaaggggagagcattgagaaaatcgac
gaggcgctggtcaaaagaggctttccggtggggccgattcagttgcttgatgaagtgggc
attgatgtcggcaccaaaattatgccggtgctggagcgcgcttacgggccgcgattcagc
gcgccgggagacgccgttgcagcaattttgaatgacgatcgcaaaggcagaaaaaatggc
cgcggtttctatctttatccggcgaaagggcgtaaaagcaaaaaacaggttgaccctgcg
gtttacgggcttattggcgttaaacccggcgggaaactgagcggcgaggagattgccgag
cgctgcgtcatgatgatgcttaacgaggcggcgcggtgtctggatgaaggcgtggtgcgt
tccgcgcgagacggcgatatcggcgcggtgtttggcatcggttttccgccgtttcttggc
ggcccgttccgctatatggacacgctcggcgcggcggccatggcgacgacgctcacgcgt
cttgccacccgttatggagaccgttttaccccgtgcgacaggctgttgcgcatggcgcag
accggacaaacattttggctcgcggggaacctgcaagctgaaatgacggtctga

DBGET integrated database retrieval system