KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_01389Help
Entry
ESA_01389         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00030  Pentose phosphate pathway
esa00480  Glutathione metabolism
esa01100  Metabolic pathways
esa01110  Biosynthesis of secondary metabolites
esa01120  Microbial metabolism in diverse environments
esa01200  Carbon metabolism
Module
esa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
esa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
esa_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:esa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ESA_01389
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ESA_01389
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:esa04147]
    ESA_01389
Enzymes [BR:esa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     ESA_01389
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     ESA_01389
Exosome [BR:esa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ESA_01389
  Exosomal proteins of colorectal cancer cells
   ESA_01389
  Exosomal proteins of bladder cancer cells
   ESA_01389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ABU76649
UniProt: A7ME97
Position
1344285..1345760
Genome map
AA seq 491 aa AA seqDB search
MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQIHPDTRILGVGRADWDKAAYTK
VVREALETFMKEKIDEALWDTLSGRLDFCNLDVNDTAAFTRLGKMLDQKNRVTINYFAMP
PSTFGAICEGLGAAKLNAKPARVVMEKPLGTSLETSREINDQVGKFFEECQVYRIDHYLG
KETVLNLLALRFANSLFVNNWDNRTIDHVEITVAEEVGIEGRWGYFDQAGQMRDMIQNHL
LQILCMIAMSPPSDLTADSIRDEKVKVLRSLRRIDRSNVREKTVRGQYTAGFAQGKKVPG
YLEEEGANKTSHTETFVAIRVDIDNWRWAGVPFYLRTGKRLPTKCSEVVVYFKTPELNLF
KDSWQDLPQNKLTIRLQPDEGVDIQVLNKVPGLDHKHNLQTTKLDLSYSETFNESHLADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSITEAWAADNDAPKPYQAGTWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaacgcaaacagcgcaggcgtgcgacttagtgattttcggcgccaaaggcgat
ctggcgcgccgaaaactgttgccttccctgtatcagctggaaaaagcgggccaaatccat
ccggatacccgcattctgggggtaggccgcgcggactgggataaagcagcctataccaaa
gtcgtccgtgaagcgcttgaaaccttcatgaaagaaaaaatcgacgaagccctgtgggac
accttaagcggccgtctcgatttttgtaatctggatgtcaacgacaccgccgcgtttact
cgtctcggcaaaatgctggatcagaaaaaccgcgtcaccattaactacttcgccatgccg
ccaagcacttttggcgcgatctgcgaaggcctgggggcggcgaaacttaacgccaaaccg
gcgcgcgtggtaatggaaaaaccgctcggcacctcgcttgaaacctcccgcgagatcaac
gaccaggtcggtaaattcttcgaagagtgccaggtctaccgtatcgaccactacctcggt
aaagagacggtgctgaacctgctggcgctgcgcttcgcgaactcgctgttcgtcaacaac
tgggacaaccgcactatcgatcacgtggaaatcaccgtggccgaagaagtgggcatcgaa
ggccgctggggctatttcgatcaggcgggccagatgcgcgacatgatccagaaccacctg
ctgcaaatcctctgcatgattgcgatgtcgccgccgtctgacctgactgccgacagcatt
cgcgacgaaaaagtgaaagtgctgcgctcgctgcgccgtatcgaccgctccaacgtgcgt
gagaaaaccgtgcgtggccagtacaccgcgggtttcgcgcagggcaaaaaagtgccgggt
tatctggaagaagagggcgccaacaaaaccagccatacggaaacgtttgtggctatccgc
gtggatatcgacaactggcgctgggcgggcgtgccgttctacctgcgtaccggtaaacgt
cttccgaccaaatgctctgaagtcgtggtctatttcaaaacgccggagctgaacctgttt
aaagattcctggcaggatctgccgcagaacaagctcactatccgtctgcagccggacgaa
ggcgtggatatccaggtgctgaacaaagtgccggggcttgatcacaagcacaacctgcaa
accaccaagctggatctgagctactcagagacctttaacgaaagccacctggccgatgcc
tacgagcgtctgctgctcgaaaccatgcgcggtattcaggcgctgttcgtgcgtcgcgat
gaagtggaagaggcctggaaatgggtcgactccatcaccgaagcctgggcggcggacaac
gacgcgccaaaaccgtatcaggccggcacctggggccctgtcgcctcggtcgcgatgatt
acccgcgacggtcgttcctggaacgagttcgaataa

DBGET integrated database retrieval system