KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_01533Help
Entry
ESA_01533         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00040  Pentose and glucuronate interconversions
esa00052  Galactose metabolism
esa00500  Starch and sucrose metabolism
esa00520  Amino sugar and nucleotide sugar metabolism
esa01100  Metabolic pathways
esa01130  Biosynthesis of antibiotics
Module
esa_M00362  Nucleotide sugar biosynthesis, prokaryotes
esa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ESA_01533
   00052 Galactose metabolism
    ESA_01533
   00500 Starch and sucrose metabolism
    ESA_01533
   00520 Amino sugar and nucleotide sugar metabolism
    ESA_01533
Enzymes [BR:esa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ESA_01533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABU76787
UniProt: A7MMI5
Position
1480762..1481670
Genome map
AA seq 302 aa AA seqDB search
MAAINSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVM
CAHPVVGNEPVAVILPDVILDEFESDLSQDNLAEMIKRFDETGRSQIMVEPVEDVTAYGV
VDCQGAQLQPGDSVPMVGIVEKPKADVAPSNLAVVGRYVLGADIWPLLAKTPPGAGDEIQ
LTDSIAMLMDKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGEEFKAWLNDTVGD
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgccattaattcgaaagtgaaaaaagcagtaatccctgttgcgggattaggaacc
aggatgttgccggccacgaaggcgattccaaaagagatgctgccgctggtggataaaccg
ttaattcagtatgtggttaatgagtgtattgccgctggcattactgagattgttctggtc
actcactcctcaaaaaattccatcgaaaaccacttcgataccagttttgaactcgaagcg
atgctggaaaaacgcgtgaagcgccagctgctggaagaagtgcagtctatctgcccgccg
cacgtgaccatcatgcaggtgcgtcagggcctcgcaaaaggtctgggccatgcggtgatg
tgcgcgcatccggttgtcggcaacgagccggtagcggtcattctgccagacgttattctc
gatgaatttgaatccgacctctcccaggacaacctggcagaaatgatcaaacgtttcgat
gagactggccgcagccagatcatggttgagccggtagaagacgtgactgcctacggcgtg
gtggactgccagggcgcgcaactgcagccgggcgacagcgtaccgatggtgggcatcgtt
gagaaaccgaaagccgacgtggcgccgtccaacctcgcggttgttggtcgttacgtgctc
ggcgcggatatctggcctctgctggcgaaaacgcctccgggagcaggtgatgagatccaa
ctgaccgactccatcgcgatgctgatggataaagaaaccgtcgaggcgtaccacatgaaa
ggcaaaagccacgattgcggtaacaaactgggttacatgcaggcctttgtggaatacgga
attcgccacaatacgctgggtgaagagttcaaagcctggcttaacgacaccgtcggcgac
aagaagtaa

DBGET integrated database retrieval system