KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_01874Help
Entry
ESA_01874         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00633  Nitrotoluene degradation
esa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:esa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ESA_01874
Enzymes [BR:esa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     ESA_01874
  1.-  
   1.-.-  
    1.-.-.-  
     ESA_01874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: ABU77128
UniProt: A7MK61
Position
1807325..1807969
Genome map
AA seq 214 aa AA seqDB search
MNLNEIIRTRHTSKAYDNSRKLTAEQQQELLDLLRFSPSSVNSQPWHFFAVTTEEGKAQI
LPALMDANQVKAKNAAMTVVFTIKEELNEAHLLQLLEKEQQDGRYDSEEARAANDKGRRF
FVGLNSETPEQQREWMTRQAYLALGFLLLGAAAMGLDATPIEGFHPEKMDEVLGLKEKGL
CSVVVATIGYRSDADFNATLPKSRLDQDVVITQL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttaatgagatcattcgcactcgccataccagcaaagcctacgataacagccgt
aaactgacggccgaacagcagcaggagctgctggatctgctgcgttttagcccctcttcc
gtcaactcccagccgtggcacttctttgccgtgactactgaagaaggcaaggcgcagatc
ctgccggcgctgatggacgccaaccaggtaaaagcgaaaaacgccgccatgaccgtggtg
ttcaccattaaagaagagctgaacgaagcgcatctgctgcagctgctggaaaaagagcag
caggatggtcgctacgacagcgaggaagcgcgcgccgcgaacgataaaggccgccgcttt
tttgtgggtctgaacagcgaaacgccggagcagcagcgcgaatggatgacccgtcaggcc
tacctggcgctcggtttcctgctgctgggcgcggccgcgatgggcctcgacgcgacgcct
atcgaaggtttccatccggagaaaatggatgaagtgctgggcctgaaagaaaaaggtctg
tgcagcgtggtggtagcgaccatcggttatcgcagcgatgccgacttcaacgccacactg
ccgaaatcccgtctggatcaggatgtggtgatcacgcagctctga

DBGET integrated database retrieval system