KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02039
Entry
ESA_02039         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Brite
KEGG Orthology (KO) [BR:esa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:esa02044]
    ESA_02039
Secretion system [BR:esa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ESA_02039
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ABU77290
UniProt: A7MFB6
Position
complement(1973284..1974366)
AA seq 360 aa
MAREPQPAHTGLTQQLGEEIWRVNFYRFCQLLEQEHPDHPLLGSTSYPENDSVRFRSWPG
MGFPASELRRVETDDEHPGSPPAVRTTFLGMYGVDSPLPGNYLDDIAQRREGQEAVSSFL
DIFGHRIATQYYRIWRKYAYPATFEPGGTDATSQCLLGLVGLGIPGTAEHIATPVSRFLA
LLGAMRLPTRNAEGIRALVTLLAPDTRAEISERDPVKVRVTNRSGLGGGERVRLAQRATL
GKMARDANSRVLITLFTRNPQEAAGWLPGGQLHTDLLALMRVYLGYRSDARLRLTVPVHL
LPEPKLAKHRRIQLGRTGLLGLKGGKLSDNRQCITVSLGCYESLSCTVLPLAAEGSYRFD
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcgcgagaaccacagccagcacataccgggctgacgcagcaattaggcgaggagatc
tggcgcgttaatttctatcgcttctgccagttgcttgagcaggaacatcctgaccatccg
ctcctgggaagcaccagctaccctgaaaatgattcggtgcggtttcgctcctggccgggc
atgggatttccggccagtgaattacgccgcgtggaaacggatgacgaacaccccggctcc
ccgcccgcggtacgcactacgtttctcggcatgtacggcgtcgactcgccgctaccgggc
aactatctggatgatatcgctcagcggcgcgaagggcaggaagccgtatcctcgtttctg
gatatcttcggccaccgtatcgccacacagtattaccgcatctggcggaaatatgcgtac
ccggccacgtttgagcccggcgggacagatgccacttctcaatgcctgcttgggctggtc
ggacttggcattcccggcacggcagaacatatcgctacccccgtttcgcgttttctcgcg
ctgctcggcgccatgcgcttaccgacgcgaaatgctgagggaatacgcgcgctggtgact
ctgctggcaccagacacacgggcagagatctctgagcgcgatcctgtaaaagtgcgggtg
acaaaccgcagcgggctggggggaggcgaacgagtacgtttagcgcagcgtgcgacactc
ggaaaaatggcgcgtgatgcaaacagtcgggtgctcattacattattcacccgcaatccg
caggaggctgcaggctggctgccgggcgggcaattgcatactgatttgctggcgctgatg
cgggtttatctcggctatcgcagtgacgcacggcttcgcctgacagtgccggtacattta
ctccctgaaccaaagcttgcgaaacatcggcgcattcagcttggccgcacaggcctgctg
ggtttgaaaggcggcaaactcagcgataaccgccagtgcatcacggtcagcctgggatgt
tatgaaagcctgagttgcacggtattgccgcttgccgcagagggcagttaccgcttcgac
taa

DBGET integrated database retrieval system