KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02090Help
Entry
ESA_02090         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K11717  cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00450  Selenocompound metabolism
esa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ESA_02090
Enzymes [BR:esa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     ESA_02090
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     ESA_02090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ABU77340
UniProt: A7MF59
Position
complement(2035722..2036942)
Genome map
AA seq 406 aa AA seqDB search
MSFSLQQIRSDFPVLTREVNGQPLAYLDSAASAQKPTAVIEAEAEFYRHGYAAVHRGIHT
LSADATQRMEAVRTRAAQFINARLPEEIVFVRGTTEGINLVANSWGDSQLHAGDNLIVTA
MEHHANIVPWQMLCARTGAELRVLPINQDGTLQLDKLPSLMDERTRLLAVTHVSNVLGTE
NPIADIIATAHQAGVKVLVDGAQAVMHHKVDVQALDCDFYLFSGHKLYGPTGIGILYAKE
EILQAMPPWEGGGAMIATVSLTEGTTWAAAPWRFEAGTPNTGGIIALGAAMDYVDAIGLE
NIHDYERTLMAYVLRELQAVPDLQIYGPQERLGVIAFNLGKHHAYDVGSFLDNYGIAVRT
GHHCAMPLMEFYGVPAMCRASLAMYNTEDEVDRLVAGLIRIHRLLG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttctctacagcagatccgcagcgacttcccggtgctgacgcgcgaggttaac
ggccagccgctggcctatctcgacagcgccgccagcgcgcagaagccgacggcggtgatt
gaggctgaggcggagttctaccgccacggctacgcggcggtgcatcgcggtatccatacc
ctgagtgcggacgcgacccagcgtatggaagctgtgcgcactcgcgccgcgcagttcatt
aacgcgcgtctgccggaagagattgtgtttgtgcgcggcaccaccgaggggataaacctg
gtggcgaacagctggggcgacagccagctgcacgcgggcgataacctgatcgtcacggcg
atggagcatcacgccaatatcgtgccctggcagatgctctgcgcgcgtaccggcgctgag
cttcgcgtgttgccgattaaccaggacggcacgctacagctcgataaactgccgtcgctg
atggacgagcgcacccgcctgctggcggtgacgcacgtctctaacgtgctcggcaccgaa
aacccgatcgcggacattatcgcgacggcgcaccaggcgggcgtcaaagtgctggtggac
ggcgcgcaggcggtgatgcaccacaaagtagacgtacaggcgctggactgcgatttctat
ctcttctctggccataagctttacgggccgaccgggatcggcattctctacgccaaagaa
gagattctgcaggcgatgccgccgtgggaagggggcggggcgatgatcgcgaccgtcagc
ctgaccgaaggcaccacctgggcggcagcgccgtggcggtttgaagccggaacgccgaac
acgggcggcattatcgcccttggcgcggcgatggattatgtcgatgccattggccttgag
aatattcacgattacgagcgcacgctgatggcgtatgtgctgcgcgagttgcaggcggtg
ccggacttacagatttatggcccacaggagcgccttggcgttatcgcgtttaatcttggc
aagcaccacgcctatgacgtgggcagttttctcgataattacggtattgcggtacgcacc
ggccatcactgcgcgatgccgctgatggagttttacggcgtgcctgcgatgtgtcgcgcg
tcgctcgcgatgtacaataccgaagatgaagtggaccggctggtggccgggcttatccgc
attcatcgtttgttaggctaa

DBGET integrated database retrieval system