KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02625Help
Entry
ESA_02625         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00020  Citrate cycle (TCA cycle)
esa00190  Oxidative phosphorylation
esa00650  Butanoate metabolism
esa01100  Metabolic pathways
esa01110  Biosynthesis of secondary metabolites
esa01120  Microbial metabolism in diverse environments
esa01130  Biosynthesis of antibiotics
esa01200  Carbon metabolism
Module
esa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
esa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
esa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ESA_02625
   00650 Butanoate metabolism
    ESA_02625
  Energy metabolism
   00190 Oxidative phosphorylation
    ESA_02625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABU77865
UniProt: A7MQY0
Position
complement(2575144..2575491)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATSIVMTLYIIYMIGFFAMNGDLTYEVWTGFFSSTFTKVF
TLLTLISILVHTWIGMWQVLTDYVKHLALRLFLQLAIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaacggcgtacatgacttcatcctggttcgc
gccacctccatcgtaatgacgctgtatatcatttatatgatcggtttcttcgcgatgaac
ggcgacctgacatatgaagtctggactggtttcttctcatccaccttcaccaaagtgttc
accctgctgaccctgatttccattctcgtccatacctggattgggatgtggcaggtgctg
accgactacgtaaaacatctggcgctgcgtctgtttttgcagctcgcgattgttgtcgcg
ctggtggtttacgtgatttatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system