KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02702Help
Entry
ESA_02702         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Brite
KEGG Orthology (KO) [BR:esa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ESA_02702
Enzymes [BR:esa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     ESA_02702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ABU77934
UniProt: A7MNQ1
Position
complement(2649892..2650680)
Genome map
AA seq 262 aa AA seqDB search
MKVAVGQFAVTPDAQQNARTCVELMANAASQNAALLVLPEALLARSDSDPDMSVKSAQPL
NGDYVQRLREESARNRLTTLLTIHTPTREGRAANTLIALRGGEIIAQYQKIHLYDAFAMQ
ESRLVDTGSALPPLIEVEGMKVGLMTCYDLRFPEMALSLALAGADVLALPAAWVRGPLKE
HHWATLLAARALDTTCYMVASGECGNRNIGQSRVVDPLGVTIAAAGECPDLIFAEISAHR
VEQVREQLPVLKNRRFAAPQLF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagcggttggacagtttgcagtgacgcctgacgcgcaacagaacgcgcgaacc
tgcgtggagctgatggcgaatgccgccagccagaatgccgcattgctggtgctcccagag
gcgctgctggcgcgtagcgacagcgacccggatatgtcggtaaaatcggcccagccgctc
aatggcgattacgtgcagcggttgcgcgaggagagcgctagaaaccgtctgacaacgctt
ctgacgattcatactcccacccgtgagggccgggcggcgaatacgctcatcgcgctgcgc
ggcggcgagattatcgcgcagtatcagaagatacatctgtatgacgccttcgcgatgcag
gagtcgcggctggtggacacgggcagcgcgctgccgccgttgattgaggtggaaggcatg
aaggtcgggctgatgacgtgctatgacttacgcttcccggagatggcgctgagcctggcg
ctcgcgggcgcggacgttctggcgctcccggccgcgtgggtgcgcgggccgctcaaagag
catcactgggccacgctgctcgcagctcgcgcgctggacaccacctgctatatggtggcg
agcggcgagtgcggcaaccgtaatattggtcagagccgcgtcgtggatccgcttggcgtg
acgattgcggcggcgggtgaatgcccggatctcatttttgcggagatttcagcgcatcgc
gtagagcaggttcgcgaacagctgccggtgctcaaaaatcgccgtttcgctgccccgcaa
ttattttga

DBGET integrated database retrieval system