KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02726Help
Entry
ESA_02726         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00270  Cysteine and methionine metabolism
esa01100  Metabolic pathways
Module
esa_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ESA_02726
Enzymes [BR:esa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     ESA_02726
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     ESA_02726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_1
Motif
Other DBs
NCBI-ProteinID: ABU77958
UniProt: A7MK12
Position
2674185..2674727
Genome map
AA seq 180 aa AA seqDB search
MSALTIFADNGASEPLWQSTDADAIREQLNAQGVRFERWQADRELGDNPTPETVLTAYQH
AIDLLVAEKGYQSWDVISMRADNPQKEALRDKFLNEHTHGEDEVRFFVEGAGLFCLHIGD
KVYQVLCEKNDLISVPAGTPHWFDMGSEPHFTAIRIFDNPEGWIANFTGSPIAEAYPRLA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattgacgatttttgccgataacggtgccagcgaaccgctgtggcagagcacc
gatgccgacgctatccgcgaacagcttaacgcgcagggcgtgcgtttcgaacgctggcag
gccgaccgcgagctcggtgataacccaacgccggagacggtgctgaccgcctatcagcac
gcgattgacctgctggtggcggaaaaaggctaccagagctgggatgtcatcagcatgcgc
gccgataacccgcagaaagaggcgctacgcgacaaatttctcaatgagcatacccacggc
gaagatgaagtgcggtttttcgtggaaggcgccgggctgttctgtctgcacatcggcgac
aaggtgtatcaggtgttgtgcgagaagaacgatctgatctcggtgcccgccggcacaccg
cactggtttgatatgggctctgagccgcatttcacggcgatccgcattttcgataacccg
gaaggctggattgcgaatttcactggcagcccgatagccgaagcgtacccgcgtctggcg
tag

DBGET integrated database retrieval system