KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02756Help
Entry
ESA_02756         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00670  One carbon pool by folate
esa01100  Metabolic pathways
esa01120  Microbial metabolism in diverse environments
esa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:esa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ESA_02756
Enzymes [BR:esa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     ESA_02756
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     ESA_02756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ABU77987
UniProt: A7MJZ6
Position
2701748..2702614
Genome map
AA seq 288 aa AA seqDB search
MAAKIIDGKTIAQQVRLEVAEKVKARVAAGKRAPGLAVVLVGANPASQIYVGSKRKACEE
VGFVSRSYDLPETTSEAELLALIDELNADAAIDGILVQLPLPAGIDNVKVLERIAPDKDV
DGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTYGLNAVVIGASNIVGRPMSMELL
LAGCTTTVTHRFTKNLRQHVENADLLIVAVGKPGFIPGEWIKEGAIVIDVGINRLENGKV
VGDVVFEEAAKRASYITPVPGGVGPMTVATLIQNTLQACVEYHDGEEA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaagattattgacggtaaaacgattgcgcagcaggtgcggcttgaagttgcc
gaaaaagtgaaagcgcgcgtggcggccggaaaacgcgctcccgggcttgcggttgtgctc
gttggcgcgaacccggcatcgcagatttatgtcggcagcaaacgtaaggcttgtgaggaa
gtgggctttgtgtcccgctcttacgatctgccggaaaccaccagcgaagctgaactgctg
gcgctgattgacgagctgaacgccgacgccgcgattgatggcattctggttcagctgccg
ctgccggccggtatcgataacgtgaaggtgctggagcgcatcgcgccggataaagacgtg
gacggcttccatccatataacgttggccgcctgtgccagcgcgcgccgcgtctgcgcccg
tgtacgccgcgcggtatcgtcacgctgcttgagcgttacaacatcgacacttatggcctg
aatgccgtggtgatcggcgcgtccaatatcgtcggccgcccgatgagcatggagctgtta
ctggcgggttgcaccaccaccgtgacccaccgcttcaccaaaaatctgcgtcagcatgtc
gaaaatgccgatttgctgatcgtcgcggtcggcaagccgggctttattccgggcgagtgg
atcaaagaaggtgccatcgtgattgatgtcggcatcaaccgtctggaaaacggcaaagtg
gtcggcgacgtggtgtttgaagaggcggccaagcgcgccagctacattacgcctgtgccg
ggcggcgttggcccgatgacggtcgccacgcttatccagaacacgctgcaggcgtgcgtt
gaataccatgacggcgaggaggcataa

DBGET integrated database retrieval system