KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03288Help
Entry
ESA_03288         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Brite
KEGG Orthology (KO) [BR:esa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ESA_03288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ABU78509
UniProt: A7MIB1
Position
3220555..3220932
Genome map
AA seq 125 aa AA seqDB search
MADSPRVCVQVQSVYIEAQSSPEDERFVFAYTVTVRNLGRTPVQLLGRYWLITNGNGKET
EVQGEGVVGVQPHIQPGGEYQYTSGAVIETPFGTMQGHYEMVDDQGNGFHLDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggctgattcaccccgcgtttgcgtacaggtacaaagcgtttatatcgaagcccagtct
tcaccggaggatgaacgtttcgtctttgcctataccgtcaccgtccgcaatctggggcga
acgcctgttcagctgctgggccgctactggcttatcaccaacggcaacggtaaagagacc
gaagtccagggtgaaggcgtggtaggggttcagccccatatccagcccggcggcgaatac
cagtacaccagcggcgcggtcattgaaacgccgttcggcacaatgcagggccactacgaa
atggtggacgatcagggcaacggttttcaccttgatatcccggttttccgcctcgccgtt
cccacactgatccattaa

DBGET integrated database retrieval system