KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03528Help
Entry
ESA_03528         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00052  Galactose metabolism
esa00500  Starch and sucrose metabolism
esa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ESA_03528
   00500 Starch and sucrose metabolism
    ESA_03528
Enzymes [BR:esa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ESA_03528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: ABU78743
UniProt: A7MIQ6
Position
3473371..3474780
Genome map
AA seq 469 aa AA seqDB search
MTTRTLLPAILQAVMKGQPVALGDRHYPRWHLAPVTGLMNDPNGFIHFQGRYHLFYQWNP
LGCAHQHKCWGHWSSADLTHWQHEPLALMPDEEYDRSGCYSGSAVDDNGRLTLCYTGNVK
FDDGTRTAWQCLAVQNADGGFDKLGPVMPLPGGYTGHVRDPKVWRHGEHWYMVLGAQDLE
LQGKVLLLRSDNLWNWENLGEIAGSTLGGLGEAGYMWECPDLFMLDGKAILITCPQGVTR
EEKRYLNTYPSAYLCGELDYDTPEFRHGPLVELDAGFEFYAPQTTLADDGRRLLIGWMGV
PDGEEMLQPTVAQGWIHQMTCPRELSLRDGLLCQQPVRELSALRGEERRLEGVAATLSPL
AAESLELMLETQGDVTLDFAATLRLEWTREGLRLSRRSLATGEWQYRYWQGDARRLHILC
DRSSVEIFINDGEGVMSSRYFPAANATLGFEGDAHLRLRYWSLRACMVE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccgcacgctgctgcctgccattttacaggctgtgatgaaaggccagccggtc
gcgcttggcgatcgccactatccgcgctggcatctggcgccggtgacgggcctgatgaac
gacccgaacggttttatccattttcaggggcgctaccacctgttttatcagtggaacccg
ctgggctgtgcgcatcagcataaatgctgggggcactggagctcggcggatctgacgcac
tggcaacacgagccgctggcactgatgccggatgaagagtatgaccgcagcggctgttat
tccggcagcgcggtggatgacaacgggcggctgacgctctgctataccggcaacgtaaag
tttgacgatggcacccgcaccgcctggcagtgtctggcggtgcagaacgcggacggcggt
tttgacaagctcggcccggtgatgccgctgcccggcggctataccggccacgtgcgcgac
ccgaaagtctggcgtcacggcgagcactggtacatggtgctgggcgcgcaggatctggaa
ttgcagggcaaagtgctgctgctgcgctccgataatctgtggaactgggaaaacctgggc
gagatcgccggcagcacgctcggcgggcttggcgaggcgggttacatgtgggagtgcccg
gatctcttcatgctggacggcaaagcgattctgatcacctgcccgcagggggtgacgcgc
gaagaaaaacgctatctcaacacctacccgagcgcgtacctgtgcggcgagcttgattac
gacacgccggaatttcgtcacggcccgctggtggagctggacgccggttttgagttttac
gcgccgcaaaccacgctggccgacgatggccgccggttacttatcggctggatgggcgtg
ccggacggcgaagagatgttgcagccaacggtggcgcagggctggatccaccagatgacc
tgcccgcgcgaactctcgcttcgcgatggcttgctctgccagcagccggtgcgcgagctt
tccgcgctgcgcggcgaggagcggcgtctggagggcgtggccgccacgctctcgccgctc
gcggcggaaagcctggagctgatgctggagacgcagggcgacgtcacgctcgatttcgcc
gccactctgcgcctggaatggacgcgcgagggcctgcggctttcacgccggagcctcgcc
accggcgaatggcagtatcgctactggcagggcgacgcccggcgcctgcatattctgtgc
gaccgttccagcgttgagattttcattaacgacggcgaaggcgtgatgagcagccgctat
ttcccggcggccaacgcgacgcttggttttgaaggcgacgcgcatctccggctgcgctac
tggtcgttacgcgcctgcatggtagaatga

DBGET integrated database retrieval system