KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03568Help
Entry
ESA_03568         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00790  Folate biosynthesis
esa01100  Metabolic pathways
Module
esa_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ESA_03568
Enzymes [BR:esa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ESA_03568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABU78779
UniProt: A7MIM6
Position
complement(3506844..3507698)
Genome map
AA seq 284 aa AA seqDB search
MAMKLFAQGSTLELSHPHVMGILNVTPDSFSDGGQHNTLTEAVKHANAMINAGATIIDVG
GESTRPGAAEVSVEEELSRVIPVVEALAQRFEVWVSVDTSKPEVIRESARAGAHIINDIR
SLTEPGALEAAAESGLPVCLMHMQGQPKTMQQAPHYDDVFADVTRFFEQHIARCEAAGIT
KEKIILDPGFGFGKNLTHNYQLLARLSEFRRFGMPLLVGMSRKSMIGQLLNVGPDQRLPG
SLACAVMAAMQGAQIIRVHDVKETVEAMRVVEATLSAKDKKYYE
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgaaactcttcgcccagggctcaacgctcgaactttctcacccgcatgtcatg
gggatcctgaatgttacgccggattctttctccgatggcggtcagcacaacacgctcaca
gaggcggtgaaacacgcgaacgcgatgattaacgccggtgcgaccatcattgatgttggc
ggcgagtcgacacgccccggagcggcggaagtgagcgtggaagaagagctttcccgcgtg
ataccggtggtggaggcgctggcgcagcgctttgaggtctgggtgtctgtcgatacctct
aaaccggaagtgatccgtgaatcggcgcgtgccggggcgcatatcattaacgatattcga
tcgctgacagagccgggcgcgcttgaggcggcggcagagagcggattgccggtttgcctg
atgcatatgcagggccagccgaaaacgatgcagcaggcaccgcattacgacgatgtcttt
gccgacgtcacacgtttttttgagcagcacatcgcccgttgcgaggcggcgggcattaca
aaagaaaaaatcatactcgacccgggattcggtttcggtaaaaatctcacccacaattac
cagcttctcgcccggctttcagaattccgacgtttcggaatgcctttgctggtgggaatg
tcgcgtaaatcgatgattggccagttacttaacgtcggacccgatcagcgcctgcccgga
agccttgcctgcgcggtgatggcggctatgcagggggcgcaaattattcgtgtccatgac
gtcaaagaaacggtcgaagcgatgcgcgtggtggaagcaactctttcagcgaaggataaa
aaatactatgagtaa

DBGET integrated database retrieval system