KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03885Help
Entry
ESA_03885         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00010  Glycolysis / Gluconeogenesis
esa00051  Fructose and mannose metabolism
esa00562  Inositol phosphate metabolism
esa01100  Metabolic pathways
esa01110  Biosynthesis of secondary metabolites
esa01120  Microbial metabolism in diverse environments
esa01130  Biosynthesis of antibiotics
esa01200  Carbon metabolism
esa01230  Biosynthesis of amino acids
Module
esa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
esa_M00002  Glycolysis, core module involving three-carbon compounds
esa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ESA_03885
   00051 Fructose and mannose metabolism
    ESA_03885
   00562 Inositol phosphate metabolism
    ESA_03885
Enzymes [BR:esa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ESA_03885
Exosome [BR:esa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ESA_03885
  Exosomal proteins of bladder cancer cells
   ESA_03885
  Exosomal proteins of melanoma cells
   ESA_03885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3254
Motif
Other DBs
NCBI-ProteinID: ABU79071
UniProt: A7MNF2
Position
3836980..3837729
Genome map
AA seq 249 aa AA seqDB search
MGNWKLNGSRHMVNELVANLRKELAGVSGCDVAIAPPAMYLDLAKQAAAGSHIILGAQNV
DVNLSGAFTGETSAEMLKDIGAKYIIIGHSERRTYHAESDELIAKKFAVLKAQGLVPVLC
IGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGVVIAYEPVWAIGTGKSATPAQAQAV
HKFIRDHIAKADAKIAEQVIIQYGGSVNAANAAELFTQPDIDGALVGGASLKADAFAVIV
KAAEEAKKA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggtaactggaaactgaacggcagccgccacatggtaaacgagctggtagctaacctg
cgtaaagagctggctggcgtatctggctgcgacgtagcgatcgccccgccggcgatgtat
ctggatctggccaagcaggccgctgctggcagccacatcattcttggtgcccagaacgtc
gacgttaacctctccggcgcgttcaccggtgaaacttccgctgaaatgcttaaagatatc
ggcgctaaatacatcattatcggccactccgagcgtcgtacttaccacgcggaatctgac
gagctgatcgcgaaaaaattcgccgtgctgaaagcgcagggtctggtgccggtactgtgc
atcggtgaaaccgaagctgaaaacgaagcgggcaaaacggaagaagtctgcgcacgtcag
atcgacgctgtgctgaaaacccagggcgccgcggcgtttgaaggcgttgtgattgcttac
gaaccggtatgggctatcggtaccggcaaatccgccactccggcgcaggcacaggcggtt
cacaaattcatccgtgaccacatcgccaaagccgacgcgaaaatcgccgagcaggttatc
attcagtacggcggttctgtaaacgcggctaacgcggcagagctgttcacccagccggac
atcgacggcgcgctggtgggcggtgcctctctgaaagcggacgcgttcgcggttatcgtg
aaagccgctgaagaagcgaaaaaagcgtaa

DBGET integrated database retrieval system