KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03903
Entry
ESA_03903         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
Organism
esa  Cronobacter sakazakii ATCC BAA-894
SSDB
Motif
Pfam: RHS_repeat RHS AHH PAAR_motif
Other DBs
NCBI-ProteinID: ABU79089
UniProt: A7MQ50
Position
complement(3847803..3852350)
AA seq 1515 aa
MSELLAARIDDPLIHSSLLADVVSGAVEGAICLAAITAGSAMMGTGLGTVAGVVLIAAVF
TTGIAEDAGDLVGQGVDAVLDFFGWLGPPDAIIKTGSHNVRIMEKAAARAAGTVDHNYLN
TPIPQESFGDQAKAFAIGTAVAILEVAQFTLHPLDNLAAGASAIASSGWDGVKKFAGSVW
DNFTQPVVAGASPYAKAAPGDIVVCTKGHTVAGTNYLAEGSKKVLINGQPASRNGDRSTC
EAKVKVKENTRVRIGGESIVVRDIRSGKNFWARLIGNTIGSLGPAIIRNLSKGMLKTLFS
RQIMKTFCCQFAADLGMGLTTFGLIQAGKVGSEARQTQHPVDIASGAKILAGGEDRDFTL
EDRIPLIWQRVYNSRNLATGMLGTGWLLPFETRFFRLENNQFIWRDMSGRELGFGELTPG
DVVDYLEDGVTLYYTVSGTLMLQMTSGEYHVYEPDPTRPGEWRLFRIYDRHENCQYYSWD
EHGRLARISGDNEALDVELAYEKTHGRLASVHQVCNGERRLLVTYGYNEHGQLTDVTDAD
GIVTRRFGWDRASDMMGWHSYSTNLSVHYQWQPAADAPNWRVCGYQVLDDQGNVLERWRI
DADEAKRCATVSCDAGFSTRHCWDYLYRITEYTDRHGGVWRYEWADYAELLTAATTPDGS
RWVYGHDEHGNLTEVRDPLGNSTFTTWHPVFAFPVKEVLPDGATWQYEYNPRGDVVSLTD
PKGGVTRFEWNEQGDLVQQTDALNNTHRFWWNERGQLVRDEDCSGNQSQRLYDAAGRPLS
ASDAEGNTDRWTLTAAGRLRTWRRADGRETHYEYDNAGLLCGQDDDGLRERKVTRNARGQ
VVSAADPAGHLTRLRYDRFGHLTTLVNPNRESWRFEYDAAGRLTGQRDYAGRLTEYRHDA
LGQVTEVIRHPLPGSADAPLVTAFEYDVLGRLTARETAEHRTEYRHNTLSLEIRRATRAE
WRQALLEEREPAWDAVLVFTRNAAGELVSEENHGGKFEYEYDALGNLSSTTFPDGRELAT
LRYGTGHLLEMQLRHGGAMHTLAAYGRDRLHREISRSQGVLSQETRYDAAGRVTQRTVLD
ARRELVFERRYRWDRTDQIVQQIHTDTTPATPGEKYSQYLWGYDAAGQVTKAVEPQKEER
FFWDPAGNRTEEHRNPVWHNLLLRLDGLKLDYDGFGRLTRRQDKSGVIQQFTYDDEQRVK
EIRFEGNAEFRRVEYRYDPLGRRTHKVLWRYGEKAPETIRFDWQGLQLAGEQSDREPDHY
VQYVYTEGSYEPLARVDSVFDDCEIYWYHTELNGLPERVTDADGQTVWRGQFSTWGETER
ELSVPQWQVPQNLRFQGQYLDRESGLHYNLFRYYDPVVGRYTQMDPIGLAGGMNTYSYVG
DPLTWVDPLGLMSCGSDAVLLRQNMIREGIEEPSFKNSAHHIVMSNSTDARMVALRQKIE
DFDLDINGSYNGVFLPTSSKVKVASGTSLPAHSKIHTNTYKQNVYERLINIDNAEEFVSE
LENISNMIMKNKFEF
NT seq 4548 nt   +upstreamnt  +downstreamnt
gtgtccgaactgttagctgcccgtatagatgatccgctcatccacagctctctgctcgcc
gatgtcgtcagtggcgcggtggagggggctatctgtcttgccgccataacggcgggttcg
gcgatgatgggcacggggctgggtacggttgcgggcgttgtattgattgcggccgtattc
accacgggtattgcagaggacgccggcgatctggtggggcaaggcgtcgatgctgtgctg
gatttcttcggctggctcggcccgccggatgcgattatcaagacaggctctcacaacgta
cgcattatggaaaaagccgccgcgcgcgcggcgggcacggttgatcacaactatctcaat
acgcccatcccgcaagagagctttggtgatcaggcgaaggcatttgcgataggcaccgcg
gttgccattctcgaagtggcgcagtttaccctgcacccgctggataacctggcggcagga
gcaagcgccatcgccagcagcggctgggacggagtaaaaaaattcgcgggcagcgtctgg
gataacttcacgcaacccgtcgtggcgggtgccagcccgtacgctaaggcggcgccgggc
gatatcgtggtgtgcaccaaaggccatacggtggccggcaccaactacctggcggaaggc
tcgaaaaaagtgctgatcaatggccagcccgcgagccgcaacggcgatcgcagcacctgc
gaagccaaagtcaaagttaaagaaaacacgcgcgtgcgcatcggcggcgaaagcatcgtg
gtgcgcgatatccgcagcggtaagaatttctgggcgcggcttattggcaacaccatcggc
agccttggcccggcgattatccgcaacctcagcaaagggatgctgaagacactcttcagc
cgccagatcatgaaaaccttttgctgccagtttgccgccgatctcggcatgggcctgacg
acattcgggctgattcaggcaggcaaagtgggcagcgaggcgcgccagacgcagcacccg
gtggatatcgccagcggcgcgaaaattctcgcgggcggcgaagaccgcgatttcacgctg
gaagaccgcattccgctcatctggcagcgtgtctacaacagccgcaacctggcgaccggt
atgctcggcaccggctggctgctgccgtttgagacccgcttcttccgccttgagaacaat
cagtttatctggcgcgatatgtcgggccgcgagctgggcttcggcgagctgacccccggc
gacgtggtggattatctcgaagacggcgtcacgctctattacaccgtcagcggcacgctg
atgctccagatgacgagcggcgagtaccacgtctacgaaccggacccgacgcgtccgggc
gagtggcggctgttccgtatctacgatcgtcacgagaactgccagtactacagctgggat
gaacacggcaggctggcgcggatttccggcgacaacgaagcgctggatgtcgaactggcg
tatgagaaaacgcatggccgtctcgccagcgtgcatcaggtatgcaacggcgagcgccgc
ctgctggtgacttacggttataacgaacacggccagttgactgacgtgaccgacgcggac
ggcatcgtcacgcgccgcttcggctgggatcgcgccagcgacatgatgggctggcacagc
tattccaccaacctgagcgtgcattatcagtggcagcccgccgccgatgcgcccaactgg
cgtgtgtgcggttatcaggtgctggatgaccagggcaacgtgctggagcgctggcgcatc
gatgccgacgaggcgaaacgctgcgccacggtcagctgcgacgcgggtttctcgacgcgc
cactgctgggattacctctaccgcatcacggaatacaccgaccgccacggcggcgtgtgg
cgctacgagtgggcggattatgccgagctgctgaccgcggccaccacgccggacggcagc
cgctgggtatacggccacgacgaacacggcaacctgacggaagtgcgcgacccgctcggc
aacagcacgttcaccacgtggcacccggtgttcgcgttcccggtgaaagaggtgctgccg
gacggcgccacctggcagtacgaatacaacccgcgcggcgatgtggtctcgctcaccgac
ccgaaaggcggcgtgacgcgctttgagtggaacgagcagggcgacctggttcagcagacc
gacgcgctgaacaacacgcaccggttctggtggaacgagcgcgggcagctggtacgcgac
gaggactgctccggcaaccagagccagcggctttatgacgcggcggggcgaccgctcagc
gccagcgacgccgaaggcaacaccgaccgctggacgctgactgcggcagggcgtctgcgc
acctggcggcgggcggacggccgcgagacgcactacgaatatgacaacgccgggctgctg
tgcggccaggacgatgacggtctgcgcgagcgtaaggtgacgcgcaacgcgcgcggccag
gtggtgagcgccgccgacccggcgggccacctgacgcgcctgcgttacgaccgcttcggc
cacctgacgacgctggtgaacccgaaccgcgagagctggcggtttgagtatgacgccgca
ggccgcctgacgggccagcgggactacgcgggccgcctgacggagtaccgccacgacgcg
ctgggccaggtgacagaggtgattcgccatccgctgccgggcagcgcggacgcgccgctg
gtgactgcgtttgaatatgacgtgctgggccgcctgactgcacgcgaaaccgcagagcac
cgcaccgagtaccgccacaacacgctgtcgctggaaatccgccgcgccacgcgcgccgaa
tggcggcaggcgctgcttgaagagcgcgagcctgcgtgggacgccgtgctggtcttcacc
cgaaacgccgcgggcgagctggtgagcgaggagaaccacggcgggaagtttgagtatgag
tacgatgcactcggcaacctcagcagcacaacattcccggatggccgcgaactcgccacg
ctgcgctacggcaccggtcatctgctggagatgcagctgcgccacggcggggcaatgcac
acgctggcggcgtacggccgtgaccggctgcaccgggaaatctcgcgcagccagggcgtg
ctctcgcaggagacccgttacgacgccgcagggcgcgtcacgcagcgcacggtgctggac
gcccgccgtgaactggtgtttgagcgccgctaccgctgggaccgcaccgaccagatagtc
cagcagatacacaccgacaccacgcctgcaacaccgggcgagaaatacagccagtacctg
tggggctacgatgccgccggtcaggtcacaaaagccgttgaaccgcagaaagaagaacgc
ttcttctgggacccggcaggtaaccgcactgaggagcaccgcaacccggtgtggcacaac
ctgctgctgcgcctcgacgggctgaagctggactatgacgggtttggcaggctaacgcgc
cgtcaggataaaagcggtgttatccagcagttcacgtatgacgatgagcagcgggtgaag
gaaatccggtttgaggggaacgcagagttccgccgtgtggagtaccgctatgacccgctt
ggccgcaggacgcataaggttctgtggcgttacggtgagaaagccccggagaccatccgc
tttgactggcagggcttacagctcgccggtgaacagagcgaccgcgagccggaccactac
gttcagtacgtctacaccgaaggcagctacgaaccgctggcgcgggtcgacagcgttttc
gatgactgcgaaatttactggtaccacaccgaactcaacggcctgccggagcgggtgacc
gacgcggacgggcagacggtctggcgcgggcagttcagcacctggggcgaaaccgaacgc
gaactcagcgtgccgcagtggcaggtgccgcagaacctgcgcttccagggccagtacctc
gaccgtgaaagcgggcttcactacaacctgttccgctattacgacccggtggtcggacgt
tacacccagatggacccgattgggttagcgggcgggatgaacacgtattcctacgtgggt
gatccgctgacgtgggtggatccgctggggttaatgagctgtggctcagacgctgttctg
ttacgacaaaatatgatccgtgagggtatcgaagagccatctttcaaaaatagtgcgcac
catattgttatgtctaattcaacagacgcacggatggttgcattaagacagaaaatagaa
gacttcgatcttgatataaatggatcttataatggcgtatttttaccaacgtcatcaaag
gttaaagttgcttctggaacaagcttgcctgcgcatagcaaaatccatacaaatacctat
aagcaaaatgtttatgaaagacttattaatattgataatgctgaagaatttgtttcggaa
ttagaaaatattagcaatatgattatgaaaaataaatttgaattttga

DBGET integrated database retrieval system