KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03905
Entry
ESA_03905         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:esa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ESA_03905
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:esa02044]
    ESA_03905
Secretion system [BR:esa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ESA_03905
SSDB
Motif
Pfam: Phage_GPD Phage_base_V bCoV_SUD_C
Other DBs
NCBI-ProteinID: ABU79091
UniProt: A7MQ52
Position
complement(3852781..3854721)
AA seq 646 aa
MEVMLNRITVQLPVEGLLFWKLSGREALSEPFMFTLTLLGTDARADRSALLGQPVTVTIP
TQALMTPRYLNGKVTRVAVSAVELSGTRYAAYELTVEPDLWPMQRDRNLRIFQGQTVPQI
VKTLLGESRVNMEERLSGSYRVWEYCVQYQESSLDFISRLLELEGIAYHFRHEQDRHTLI
LTDAPGQYEPFPGYETIPYHVTPSGGSTDEEGISQWALEDSVTPGIYSLDDYDFRKPNAW
LFQARQNPLSPQPGSIDVYDWPGRFVEHGHGEFYARIRQERWQVEHRQTQGTATALGIAP
GHTFVLRNAPFFGDNGEYLTTIAHYRFEENRYASGPDSNTLHEIRFEVIPADVPYRPAQK
TPWPRTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLGKGDDTSSSWVRVSSAWAGQG
FGGVQIPRVGDEVVVDFINGDPDRPLITGRVYNEASMPPWALPAAATQMGFLSRSKDGSP
DNANALRFEDKAGEEQVWLQAERNLDTKVKKDETHSVGGSRILSVKQDYTGKVEGKQEHA
IQMSRNELVGGQYDIKGQGTVTVSSATGIRLVTGDSVLEMSANGEVNLYCTKFAINASGT
GQINTGGTLDLNLKNEPDKASNVAPTPGDIQNEVAKTFNSDGEGQA
NT seq 1941 nt   +upstreamnt  +downstreamnt
atggaagttatgctcaaccgaatcaccgttcagctcccggtcgaggggctgcttttctgg
aaactctccgggcgcgaggcgctgtcggagccgttcatgttcaccctgacgctgctcggc
accgatgcgcgcgccgaccgcagcgcgctgctggggcagccggtgacggtgaccatcccg
acccaggcgctgatgacgccgcgctacctcaacggcaaggtgacccgcgtggcggtgagc
gcggtggagctgtccggcacccgttatgcggcctatgagctgacggtggagccggacctg
tggccgatgcagcgcgaccgcaacctgcgtatcttccaggggcagacggtgccgcagata
gtgaaaacgctgctgggcgaaagccgggtgaacatggaagagcgcctttccggcagctac
cgcgtctgggaatactgcgtgcagtaccaggagagcagcctggacttcatcagccgtctg
ctggagctggagggcatcgcctaccacttccgccacgagcaggaccgccacacgctcatc
ctcaccgatgcccccggccagtacgagccgttccccggctacgagaccattccgtaccat
gtgaccccttcaggcggcagcacagacgaagagggcatcagccagtgggcgctggaagac
agcgtgacgccgggcatctacagcctcgacgactacgacttccgcaagccgaacgcctgg
ctgttccaggcgcggcagaacccgctgtcgccgcagccggggagtattgacgtttacgac
tggccgggccgttttgtggagcacggtcacggcgagttctacgcccgcatccgccaggag
cgctggcaggtggagcaccgccagacgcagggcaccgcgacggcgctcggcatcgcgccc
ggccacacctttgtgctgcgcaacgccccgttcttcggcgacaacggcgagtacctcacc
accatcgcccactaccgcttcgaggagaaccgctacgccagcggcccggacagtaacaca
ctgcacgaaatccgctttgaggtgataccggcggacgtgccgtaccgcccggcgcagaag
acgccgtggccgcgcacctacggcccgcagacggcgaaggtggtcggcccgcagggtgag
agcatctggacggataaatatggccgcgtgaaggtgaagttccactgggaccgcctcggc
aagggtgacgacaccagctccagctgggtgcgcgtctccagcgcctgggcgggccagggc
ttcggcggggtgcagataccgcgcgtgggcgacgaagtggtggtggacttcatcaacggc
gacccggaccgtccgctgataacgggccgcgtgtacaacgaagccagcatgccgccgtgg
gcgctgccggcggcggccacacagatgggctttttaagccgctcgaaggacggctcgccg
gataacgccaacgccctgcgctttgaggacaaggcgggcgaggagcaggtgtggctgcag
gccgagcgcaaccttgataccaaagtgaaaaaagatgaaacccacagcgtcggcggctcg
cggatactttctgtaaagcaggactacaccggcaaggttgaaggcaagcaggaacacgcc
attcagatgagccgcaatgagctggtcggggggcagtacgacatcaagggccagggcacg
gtcaccgtttcttccgcgactggtattcgcctggtcacgggcgattcggtgctggaaatg
agcgcgaacggcgaggtcaatctctactgtacaaaattcgcgatcaacgccagcggcaca
gggcaaatcaataccggcggcacgctcgatctgaaccttaagaatgaaccggacaaagcg
tcaaacgtcgcgccgacgcctggggatatccagaacgaagtggcaaaaacatttaattcc
gacggagagggacaggcatga

DBGET integrated database retrieval system