KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03921
Entry
ESA_03921         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K11907  type VI secretion system protein VasG
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:esa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ESA_03921
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:esa02044]
    ESA_03921
Secretion system [BR:esa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ESA_03921
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 ClpB_D2-small AAA_16 Sigma54_activat AAA_22 AAA_7 TniB Clp_N NACHT AAA_14 ATPase_2 AAA_18 AAA_25 ABC_tran_CTD Zeta_toxin IstB_IS21 SRP54 AAA_30 TsaE Hpr_kinase_C CbiA DUF815 betaPIX_CC AAA_33
Other DBs
NCBI-ProteinID: ABU79107
UniProt: A7MQ33
Position
complement(3871329..3873944)
AA seq 871 aa
MSEISRAVLFGKLDTLLFTSLESATSFCKLRGNPYVELAHWLHQLMQQQDGDLQHLIRHF
SLDEEALSRDIVAALDRLPRGASSVSDLSEHIDSAVERAWVYGSLKFGVTRIRGGHLLIG
ILKTFNLANVLKGISSQFNRISADLLVEQFDAIFAGSKEAQQAVAAAPDAAGNAPVQQGT
LAQYGQDLTARAREGKIDPVVGRDEEIRQMVDILMRRRQNNPLLTGEAGVGKTAVVEGLA
HRIAAGDVPEPLQNVQLWLLDIGMLQAGAGMKGEFEARLQGLINEVQSSATPIVLFIDEI
HTLIGAGGQQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIEKDPALTRRFQTVQVHE
PDEEKAVLMLRSTVSPLEKHHRVLLLDEAVSAAVKLSHRYIPARQLPDKAVALLDTACAR
VAVSQSAPPPQLEDCLHRIAALEVEAEIAEREARVAVGDGERVARLNAEREALEAERDAL
TARWEEERALVDAIIALRAELHMADEEAQPALRETLAERQKALAAVQGDAPLLFAAVDAN
VVAAVVSDWTGIPLGRMVKNEIDAVLKLADTLNQRVIGQRHGLELIAKRVRTSRARLDDP
NKPVGVFMLCGPSGVGKTETALALAESLYGGEQNVITINMSEFQEAHTVSTLKGAPPGYV
GYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHEIFFQVFDKGWMEDGEGRHIDFRNTII
ILTSNVGTDLISAMCADPDLMPEPDALSAALRQPLLQVFPPALLGRLLVVPYYPLSDAML
AEIVKLQLKRIQRRLEENHGIISEFDDSVITQIVARCTEVESGGRMVDAILTNTLLPQMS
QILLTASAQDEKYRRLRVTFEQGEFQCQFAA
NT seq 2616 nt   +upstreamnt  +downstreamnt
atgtcagaaatcagccgtgccgtactgttcggcaaactggatacgctgttgtttacctcg
ctggaaagcgccacctccttctgcaagctgcgcggcaacccgtatgtggagctggcgcac
tggctgcatcagctgatgcagcagcaggacggggatttacaacatctgatccgccatttt
tcactggatgaagaggcgctgagccgggatatcgtggcggcgctggatcgcctgccgcgc
ggcgcaagttccgtttccgatctctcggagcatatcgacagcgcggtggagcgcgcgtgg
gtgtacggctcgctgaaattcggcgtgacgcgcattcgcggcgggcatctgctgatcggc
attctgaaaacctttaacctggcgaacgtgctgaaaggcatctccagccagttcaaccgc
atcagcgccgacctgctggtcgagcagttcgacgccatcttcgcgggcagcaaagaggcc
cagcaggcggtcgccgccgcgccggacgccgccggtaacgcgccggtgcagcagggcacg
ctcgcgcagtacggccaggatctcaccgcgcgtgcgcgtgaaggcaaaatcgacccggtg
gtcgggcgtgatgaagagatccgccagatggtggatattctgatgcgtcgccgtcagaac
aacccgctgctgaccggtgaagcgggcgtgggtaaaaccgcggtcgtggaaggcctggcg
caccgcatcgccgcgggcgatgtcccggagccgttgcaaaacgtgcagctgtggctgctc
gatatcggcatgttgcaggcgggcgcgggcatgaaaggcgaatttgaagcgcgtctgcag
gggcttatcaatgaagtgcagtccagcgccacgccgattgtgctgtttatcgatgagatc
cacacgcttatcggcgcgggcggccagcagggcaccggcgatgccgccaacctgctgaaa
ccggcgctggcgcgcggccagctgcgcaccatcggcgcgaccacctgggcggaatataaa
aaatacatcgagaaagacccggccctgacgcgccgcttccagaccgtgcaggtgcatgag
ccggatgaagaaaaagccgtgctgatgctgcgcagcaccgtctcgccgctggaaaaacat
caccgcgtgctgctgctggacgaagcggtcagcgcggcggtgaaactgtcgcaccgctac
attccggcgcgccagctgccggataaagccgtcgcgctgctggataccgcctgcgcgcgc
gtcgccgtcagccagagcgcgccgccgccgcagttagaagattgcctgcaccgcatcgcg
gcgctggaagtggaagcagaaatcgccgagcgcgaagcgcgcgtggcggtgggcgacggc
gagcgcgtggcgcgtctgaacgctgagcgtgaagcgctggaagccgaacgcgacgccctg
accgcccgctgggaagaagagcgcgcgctggtggatgcgattatcgccctgcgcgccgag
ctgcatatggccgatgaagaagcccagcctgcgctgcgcgagacgctggcggagcgccag
aaggcgctggccgccgttcagggcgacgcgccgctgctgttcgccgcggtggacgcgaac
gtcgtcgcggcggtggtctccgactggaccggcatcccgctgggccgcatggtgaaaaat
gagatagacgcggtgctgaagcttgccgacacgctaaaccagcgcgttatcggccagcgt
catgggcttgagcttatcgccaaacgcgtgcgcacctcccgcgcgcgccttgatgacccg
aacaagccggtgggcgtctttatgctctgcggcccgtccggcgtcggtaaaaccgaaacc
gcgctggcgctcgccgagtcgctgtacggcggcgagcagaacgttatcaccatcaacatg
agcgagttccaggaagcgcatacggtttccacgctgaaaggcgcgcctccgggctacgtg
ggctacggcgaaggcggcgtgctgaccgaagcggtgcgtcgtcgtccttacagcgtcgtg
ctgctcgatgagattgaaaaagcgcacccggacgtgcatgagattttcttccaggtgttc
gataaaggctggatggaagatggcgaagggcgtcatatcgatttccgcaacacgattatc
atcctgacgtctaacgtcggcaccgatcttatcagcgccatgtgcgccgacccggacctg
atgccggagccggatgcgctcagtgcggcgctgcgtcagccgcttttgcaggtttttccg
cctgcactgctgggccgattgttggttgtgccgtattatccgttaagcgacgcgatgctg
gccgaaattgtgaaattgcagcttaagcggatccagcgtcgtcttgaggaaaatcacggt
attatttccgaattcgacgacagcgtaattacccagattgtggcgcgttgcaccgaggtg
gaatccggcggccgtatggtcgatgcgatccttaccaacaccctgctgccgcagatgagc
cagatactgctcaccgccagcgcgcaggacgagaaatatcgccgtctgcgcgtgacgttc
gagcagggcgagtttcagtgtcagtttgcggcgtaa

DBGET integrated database retrieval system