KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03928
Entry
ESA_03928         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K07169  FHA domain-containing protein
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Brite
KEGG Orthology (KO) [BR:esa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    ESA_03928
SSDB
Motif
Pfam: FHA UreE_N Yop-YscD_cpl
Other DBs
NCBI-ProteinID: ABU79114
UniProt: A7MQ23
Position
complement(3880313..3882244)
AA seq 643 aa
MRFTITTNKPGHQPPQSSCDFYPPGGTIGRGTDNNLVLPDNERTISRLQAIVHISADGEC
RITNRGNVTRVVLNDIPLERGRQVELQDGDVLGIDDYRIQVSDLALNAQPVIAMAAPKPN
VAPQQPQAPQPAKPQQPPKADAQDNAPTAVPTEIWDSLMQEFSISDSISQGQSQSARPKT
PEAQPFNPFNAPKEADRNPEDPLAHFQSGGNEPLFGNERVNPDSLFKDDTPFDKDSIFND
VTPTTLVPPSDNRQAAKPQAPHKENEEELDPLALFGGVGSTPVQSRSDDPLGLMMGGAVP
LTPPDELNAGAAPLTPPPTAKQDAEPVKPAISPEKPQPEKPQPEMTTSPLAPNADDSIDL
ASLAGSPLFPEEVPEEPVTRVEVQPTPPEVQDYAGITLPTPQAVARSTAQTPKGRLRIDP
VQSPTSQGGTPTASNGDVLNGELLEALLEGMGLGELQPTPQFDRDNMRQLGQMLSMFSQG
TVALLSSRSILKRGVKADMTMVLDDANNPFKLLPSGKTVLMQMFGTRMPGFMPPKKSVRD
ALIDLQAHQLGMIAGIRAIIAAMLQSFNPEQLEEEAKRDGAISRLALPASRKAALWDYFV
RHYSDTAGEIEDDFHTLFGEAFLHAYDMEVNQYKDSQSGSEEE
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgcgattcacgattactaccaacaagcccggccaccagcctcctcagagcagctgtgac
ttctacccgccgggcggcacgattggccgtggtacggataacaatctggtactgccggat
aacgaaagaacgatttcccgcctgcaggcgattgtccatatctccgcggacggcgagtgc
cgcatcactaaccgcggcaacgtcacccgcgtggtgctgaacgatattccgctcgagcgc
ggccggcaggtggagttacaggacggcgacgtgctcggcattgacgattaccgcattcag
gtgagcgatctggcgctgaacgcgcagccggttatcgcgatggccgcgccgaaaccgaac
gttgcgccgcagcagcctcaggcgccgcagcctgcgaaaccgcagcagccgccgaaagcc
gacgcgcaggacaacgcgccaacggcggtgccgaccgaaatctgggacagcctgatgcag
gagttctctatctccgacagcatcagccagggtcagagccagagcgcgcgcccgaaaaca
ccggaagcgcagccgtttaacccgttcaacgccccgaaagaggcggatcgcaacccggaa
gatccgctggcgcacttccagagcggcggcaacgagccgctgttcggcaatgaaagggtc
aacccggacagcctgttcaaagatgacacgccgttcgataaagacagcattttcaacgat
gtgaccccgaccacgctggtgccgccgtctgataaccgtcaggccgcaaaaccgcaggca
ccgcataaagagaatgaagaagagctcgatccgctggcgctgtttggcggcgtgggctcc
acgccggtacagagccgcagcgacgatccgcttggcctgatgatggggggcgctgtaccg
ctgacgccgccggatgagcttaacgcaggcgctgcgccattaacgccgccgcccaccgcg
aagcaggacgccgagccggttaaaccagcaatttcacccgaaaaaccgcagcccgaaaaa
ccgcagccggagatgacgacctcgccgctcgcgccaaacgcggacgactcaatcgatctg
gcgtcgctcgccggttcgccgctgttcccggaagaagtgccggaagagccggtgacgcgc
gtggaagtccagccgacaccgccggaagtgcaggattacgccggtatcacgctgccgacg
ccgcaggcggtggcgcgcagcaccgcgcagacgccaaaaggccgcctgcgcatcgacccg
gtgcagtcgccgaccagccagggcggcacgcctacggcgtctaacggcgacgtgctgaac
ggcgagctgctggaagcattgctggaaggtatgggtcttggcgagctgcaaccgacgccg
cagtttgaccgcgacaatatgcgccagctcggccagatgctcagcatgttctcgcagggc
accgtggcgctgctctcctcgcgctcgattctcaagcgcggcgtgaaagccgacatgacg
atggtgctggacgacgccaacaacccgttcaagctgctgccgtcgggcaaaacggtactg
atgcaaatgttcggcacccgtatgccgggctttatgccgccgaaaaaatcggtgcgcgac
gcgcttatcgatctccaggcgcaccagcttgggatgatcgccggtatccgcgccatcatc
gccgctatgctgcaatcttttaacccggagcagcttgaagaagaggcgaagcgcgacggc
gctatctcgcgtctggcgctgccggcgagccgcaaagccgcgctgtgggattactttgtg
cgtcattacagcgataccgcgggcgagatcgaggacgatttccatactctgtttggcgaa
gccttcctgcacgcttatgacatggaagtgaatcagtacaaagactcacaaagcggatcg
gaagaagaatga

DBGET integrated database retrieval system