KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_03942
Entry
ESA_03942         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Brite
KEGG Orthology (KO) [BR:esa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:esa02044]
    ESA_03942
Secretion system [BR:esa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ESA_03942
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABU79128
UniProt: A7MQ06
Position
complement(3888445..3888981)
AA seq 178 aa
MENIMPMSNSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVFADLVGKPVDPQPA
VDERKFLEIDIDNFDERMKALKPRVAFQVDNTLTGEGKLNIDLTFDSMDDFLPDAVARKV
EPLNKLLEARTQLSNLLTYMDGKNGAEELIAKVLQDPTLLKSLSQMPKDDDGTKGNEE
NT seq 537 nt   +upstreamnt  +downstreamnt
atggagaacatcatgccaatgagtaacagtgggcagaaatttatcgcccgtaaccgcgcg
ccgcgcgtgcagatcgagtacgacgtggaaatctacggtgcggaacgcaaaattcagctt
ccgtttgtaatgggcgtgtttgccgacctggtcgggaagccggtcgatccgcagcctgcg
gtggacgaacgtaaattccttgaaattgatatcgacaacttcgacgagcgtatgaaagcg
ctcaagccgcgcgtggcgttccaggtggacaacaccctgaccggcgaaggcaaactgaac
atcgatctcactttcgacagcatggacgacttcctgccggacgccgtcgcgcgtaaggtc
gagccgctgaacaagctgctggaagcccgtactcagctctctaacctgctgacctacatg
gacggtaaaaacggtgccgaagagcttatcgcgaaagtgcttcaggacccgacgctgctc
aaatcgctgagccagatgccgaaagatgacgatggcaccaaaggtaacgaggagtaa

DBGET integrated database retrieval system