KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_04058Help
Entry
ESA_04058         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K08318  4-hydroxybutyrate dehydrogenase / sulfolactaldehyde 3-reductase [EC:1.1.1.61 1.1.1.373]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00650  Butanoate metabolism
esa01100  Metabolic pathways
esa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:esa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ESA_04058
Enzymes [BR:esa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.61  4-hydroxybutyrate dehydrogenase
     ESA_04058
    1.1.1.373  sulfolactaldehyde 3-reductase
     ESA_04058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored UDPG_MGDP_dh_N 3HCDH_N 2-Hacid_dh_C Rossmann-like IlvN TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABU79239
UniProt: A7MQD1
Position
complement(4009170..4010069)
Genome map
AA seq 299 aa AA seqDB search
MATIGFIGLGQMGAPMAANLLRHGHRLQVCDVNTSAVETLASEGATACATPQAAAQGAEF
VITMLPNGDLVREVLLGDNGVCQSLSREALVIDMSTIHPLQTDRLISDLAARGFSMMDVP
VGRTSDHAKSGTLLLLAGGTPERVTRAEPVLMAMGSELIRAGGPGMGIRVKLINNYMSIA
LNALSAEAAVLCEALGLSFDVALQVMSGTPAGKGHFTTSWPNKVLKGDLSPAFMIDLAHK
DLGIALDVANQLHVPMPLGAASREVYSQARASGRGRQDWSAILEQVRVSAGLTPRQATL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgattggatttatcggactgggacagatgggcgcgccgatggcggcaaacctg
ctgcgccacgggcaccggttgcaggtgtgcgatgtaaacaccagcgccgtggagacgctg
gcgtcagagggcgcgacggcgtgcgccacgccacaggctgccgcccagggcgcggaattc
gtgattaccatgctgccgaacggtgatctggtgcgcgaggtgctgcttggcgataacggc
gtctgccagtcgctctcccgcgaggcgctggttatcgacatgtccaccattcacccgctg
caaaccgacaggctgataagcgatctcgccgcgcgcggcttcagcatgatggatgtgccg
gtgggccgtacctcggatcatgcgaaatccggcacgctgctgctgctggcgggcggaacg
ccggagcgggtgacgcgtgccgagccggtgctgatggcgatgggttcagagctcatccgc
gcaggcgggccgggaatgggcattcgcgtcaagcttatcaataactacatgagcatcgcg
ctcaacgcgctctccgccgaagccgccgtgctgtgtgaagcgctcgggctttcgttcgat
gtggcgctgcaggtgatgagcggtacgcctgccggtaaaggccacttcaccacttcctgg
ccgaacaaagtgctcaaaggcgatctctcacccgccttcatgattgaccttgcccataaa
gatttaggcatcgcgctggacgtggcgaatcagctgcatgtgccgatgccgcttggtgct
gcctcgcgggaagtctacagccaggcgcgcgccagcgggcgcggtcgccaggactggtcc
gccattttagaacaggttcgcgtcagcgccgggctgacgccgcgccaggccacgctttga

DBGET integrated database retrieval system