KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_04309Help
Entry
ESA_04309         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00500  Starch and sucrose metabolism
esa01100  Metabolic pathways
esa01110  Biosynthesis of secondary metabolites
Module
esa_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ESA_04309
Enzymes [BR:esa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ESA_04309
Exosome [BR:esa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ESA_04309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ABU79488
UniProt: A7MGF1
Position
4269737..4271965
Genome map
AA seq 742 aa AA seqDB search
MGRHQINRMITMSDRVSRDVINALIAGHFSDPFSVLGMHTTDAGIEVRALLPDATEVWVI
EPKTGRKVGKLECLDSRGFFSGVMPRRKNPFRYQLAVVWHGQQNLIDDPYRFGPLLQELD
VWLLSEGTHLRPYETLGAHPDTMDGVTGTRFSVWAPNAQRVSVVGQFNYWDGRRHPMRLR
KESGIWELFIPGAHNGQLYKYEMIDANGHLRMKSDPYAFEAQMRPDTASLICGLPEKVEP
NTARQDANRFDAPISIYEVHLGSWRRHTDNNFWLSYRELADQLIPYVKWMGFTHIELLPV
NEHPFDGSWGYQPTGLYAPTRRFGTREEFRYFINAAHAAGLNVILDWVPGHFPSDDFALA
NFDGTALYEHSDPREGYHQDWNTLIYNYGRREVSNFLVGNALYWTERFGIDALRVDAVAS
MIYRDYSRKEGEWIPNQYGGRENLEAMEFLRNTNRIIGEQVNGAVTMAEESTDFPGVSRP
PESGGLGFWYKWNLGWMHDTLDYMKLDPVYRQYHHHKMTFGMIYNYTENFVLPLSHDEVV
HGKKSILDRMPGDAWQKFANLRAYYAWMWGFPGKKLLFMGNEFAQGREWNHDASLDWHLL
EGDDNWHHGVQRLVRDLNSTYRHHKALHELDFDPYGFEWLVVEDNQNSVFIFVRRDSQGN
EIIVASNFTPVVRHNYRFGINQPGEWREILNTDSQHYHGSNAGNGGKVRSEAIASHGRDN
SLSLTLPPLATIWLVREADDAA
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggggcgacaccaaataaacaggatgataaccatgtctgatcgtgtctcaagagacgtg
attaatgcgctgattgcgggccatttttcggatcctttctccgttctgggcatgcacacc
accgacgccgggatcgaagtccgtgcgctgcttcccgacgctactgaagtctgggtcatc
gaacccaagaccgggcgtaaagtgggcaagcttgagtgtctggattctcgcggttttttc
agcggcgtgatgccgcgtcgtaaaaatccttttcgctatcaactggccgtggtctggcac
ggacagcaaaatctgattgatgacccgtatcgcttcgggccgctgcttcaggagctggat
gtctggctgctttccgaaggcacgcatttacgtccttatgaaacgctcggcgcgcacccg
gatacgatggacggcgtcaccggcacgcgcttttccgtctgggcgccgaacgcgcagcgc
gtctccgtggtggggcagttcaactactgggatggccgccgccacccgatgcgtctgcgt
aaagagagcggcatctgggaactcttcatccccggcgcgcacaacggccagctctataaa
tatgaaatgatcgacgcgaacggccatttgcgcatgaaatccgacccgtatgcgtttgag
gcgcagatgcgcccggataccgcgtcgcttatctgcggcctgccggaaaaagtcgagccg
aacacggcgcgccaggacgctaaccgcttcgatgcgccgatctcgatttacgaagtgcat
ctgggttcatggcgtcgccataccgacaacaatttctggctgagctaccgcgagctggct
gaccagctgatcccgtatgttaagtggatgggctttacccatatcgaactgttgccagtt
aacgaacacccgttcgacggcagctggggctatcagccgaccgggctgtacgcgccgacg
cgccgtttcggcacgcgcgaagagtttcgctatttcatcaacgccgcgcacgccgcgggg
ctgaacgttattctcgactgggtgccgggccacttcccgtccgatgatttcgcgctggcg
aattttgacggcacggcgctctatgagcacagcgacccgcgcgaaggctatcaccaggac
tggaacacgcttatctacaactatggccgccgcgaagtgagcaacttcctggtgggcaac
gcgctctactggacggagcgttttggcatcgacgcgctgcgtgtggacgccgtcgcctca
atgatttatcgcgactacagccgcaaagaaggcgagtggatcccgaaccagtacggcggg
cgcgaaaacctggaggcgatggagtttctgcgcaacaccaaccgcattatcggcgagcag
gtcaacggcgcggtgacaatggcggaagagtccaccgatttccctggcgtctcacggccg
ccggaatcgggcgggcttggcttctggtacaagtggaacctgggctggatgcacgacacg
ctcgactacatgaagctcgatccggtctatcgccagtaccatcaccacaaaatgaccttc
gggatgatttacaactacaccgaaaactttgtcctgccgctgtcgcatgacgaagtggtg
catggcaaaaaatcgattctcgatcgtatgcctggcgacgcctggcagaaattcgccaac
ctgcgcgcctactacgcgtggatgtggggcttcccgggtaaaaaactgctgttcatgggc
aacgagtttgcgcaggggcgcgagtggaaccacgacgccagcctcgactggcatctgctg
gaaggcgacgacaactggcaccacggcgtgcaaagactggtgcgcgatctcaattccaca
tatcgccaccacaaagcgctgcatgaacttgatttcgatccttatggcttcgaatggtta
gtggtagaggataaccagaactcggtatttatcttcgtgcgccgcgattcgcagggcaat
gaaatcatcgtcgccagtaacttcacgccggtggtgcgccataactatcgctttggcatt
aaccagccgggcgagtggcgcgaaatcctgaatacggattcgcagcactatcatggcagc
aacgccgggaacggcggcaaggtgcgcagcgaggccatcgccagccacgggcgtgacaat
tcgctctccctgacgctgccgccgcttgccactatctggctggtcagagaggcagatgat
gcagcttaa

DBGET integrated database retrieval system