KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_04334Help
Entry
ESA_04334         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:esa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ESA_04334
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:esa02022]
    ESA_04334
Two-component system [BR:esa02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   ESA_04334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: ABU79513
UniProt: A7MGC7
Position
4303097..4303855
Genome map
AA seq 252 aa AA seqDB search
MALQLFEPLGVNTMQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRE
SFHLMVLDLMLPGEDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPF
NPRELLARIRAVLRRQANELPGAPSQEEAIIAFGKFKLNLGTREMFREDEPMPLTSGEFA
VLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWG
LGYVFVPDGAKA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcgttacaactgtttgagcctttgggagtaaacacaatgcaggaaaattacaagatt
ctggtggtggatgacgatatgcgcctgcgcgcgctgcttgagcgttacctcaccgagcag
ggcttccaggtgcgcagcgtggcaaacgccgaacagatggaccgcctgctgacccgcgag
tccttccacctgatggtgcttgatctgatgcttcctggtgaagacgggctttctatctgc
cgccgtctgcgcagccagagcaacccgatgcctatcatcatggtcaccgcgaaaggcgaa
gaggtcgatcgtatcgtggggctggagattggtgccgacgactatattcctaaaccgttc
aacccgcgtgagctgctggcccgcatccgcgcggttctgcgccgtcaggccaacgaactg
ccgggcgcgccgtcgcaggaagaagcgattatcgccttcgggaaattcaagctcaatctg
ggaacgcgcgagatgttccgcgaagatgagccgatgccgctcaccagcggtgaattcgcc
gtcctgaaagcgctggtcagccacccgcgcgagccgctgtcgcgcgataagctgatgaac
ctggcgcgcgggcgtgaatactccgcgatggaacgctccatcgacgtgcagatctcccgt
ctgcgccgcatggtggaagaagatccggcgcatccgcgctatatccagaccgtctggggc
ctgggctacgtctttgtgccggacggcgctaaagcatga

DBGET integrated database retrieval system