KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_pESA3p05481
Entry
ESA_pESA3p05481   CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:esa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ESA_pESA3p05481
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:esa02044]
    ESA_pESA3p05481
Secretion system [BR:esa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ESA_pESA3p05481
SSDB
Motif
Pfam: T6SS_HCP Candida_ALS
Other DBs
NCBI-ProteinID: ABU79678
UniProt: A7MRP5
Position
pESA3:43387..43995
AA seq 202 aa
MRFVLISGAVLFSVLNELTVKPNYLPPGFAYSHLLSDNTEYYMAIDMFLKVEGVTGESKD
ANHASWIDVLSFNWGAAQPGNMAVGGGGGAGKVNFQDLAVQAIVDKGTPAILKFCASGKH
VNKVELSVCKAGGQQVEYSKIVLEDVLVTRTEFTGVGQTDTVLVSYYFQAAKVNFHYWEQ
SNQGTKGAETKAGWDIKQNKEL
NT seq 609 nt   +upstreamnt  +downstreamnt
atgagattcgtcttaatttccggagcggtattgtttagcgttttgaatgaacttacagtg
aaaccgaattatttgcctccgggctttgcttattctcacctgctatctgataacacggag
tattacatggctattgatatgttcctgaaagtggaaggcgtgaccggcgaatctaaagat
gctaatcatgccagctggatcgatgtcctttcttttaactggggcgcagcgcagccgggc
aatatggcggtcggcggtggcggcggtgccggtaaagttaactttcaggatttagccgta
caggccattgtggataaaggcacgcccgccattcttaaattctgcgccagcggtaaacat
gtcaataaggtggagctttctgtctgtaaggccggtggtcagcaggtagaatattcaaaa
atcgttcttgaagatgtgctggtgacccgcacggaattcacgggcgtggggcagacagat
acggttcttgtcagttactacttccaggccgcgaaggtgaatttccattactgggaacag
tcgaaccagggtaccaaaggtgcggaaaccaaagccggttgggatattaaacaaaataaa
gagctctga

DBGET integrated database retrieval system