KEGG   Enterobacter lignolyticus SCF1: Entcl_0096Help
Entry
Entcl_0096        CDS       T01342                                 

Definition
(GenBank) fructose-1,6-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00010  Glycolysis / Gluconeogenesis
esc00030  Pentose phosphate pathway
esc00051  Fructose and mannose metabolism
esc00680  Methane metabolism
esc01100  Metabolic pathways
esc01110  Biosynthesis of secondary metabolites
esc01120  Microbial metabolism in diverse environments
esc01130  Biosynthesis of antibiotics
esc01200  Carbon metabolism
Module
esc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entcl_0096
   00030 Pentose phosphate pathway
    Entcl_0096
   00051 Fructose and mannose metabolism
    Entcl_0096
  09102 Energy metabolism
   00680 Methane metabolism
    Entcl_0096
Enzymes [BR:esc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Entcl_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: ADO46374
UniProt: E3G8I5
Position
complement(99505..100515)
Genome map
AA seq 336 aa AA seqDB search
MRRELAIEFSRVTEAAALAGYKWLGRGDKNAADGAAVHAMRIMLNQVNIDGTIVIGEGEI
DEAPMLYIGEQVGTGNGDAVDIAVDPIEGTRMTAMGQANALAVLAVGDKGCFLNAPDMYM
EKLIVGPGAKGVIDLSLPLADNLRNIAAALGKPLDELTVTILAKPRHDAVIDELQQLGVR
VFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVVSAAVIRALDGDMQGRLLARHEVKG
DSDENRRIGESELARCAAMGIEAGKVLRLDDMARSDNVIFSATGITKGDLLEGISRKGNM
ATTETLLIRGKSRTIRRIQSIHYLDRKDPDVQRHIL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagacgagaacttgccatcgaattttcacgcgttaccgaagcggcggcgcttgcgggc
tacaaatggctagggcgcggcgataaaaacgcggccgacggcgcggcggtacacgccatg
cgcatcatgcttaaccaggtcaatatcgatggcaccatcgttatcggcgaaggggagatc
gacgaggcgccgatgctctatatcggcgaacaggtcgggaccggcaacggcgacgcggtg
gatatcgccgtcgaccctatcgaaggcacgcgcatgacggcgatgggccaggccaacgcg
ctggcggtactggcggtcggcgataagggctgtttcctgaacgcgccggacatgtacatg
gaaaaactgattgtcggcccgggcgccaaaggggttatcgacctcagtctgccgctggcg
gacaacctgcgcaacatcgcagcggcgcttggcaaaccgctcgacgagctgaccgtcact
attctggcgaaaccgcgtcatgacgcggttatcgatgaactccagcagctcggcgtgcgc
gtattcgccattccggacggcgacgttgccgcctctatcctcacctgcatgccagacagc
gaagtcgacgtcctgtacggtatcggcggcgcgccggaaggcgttgtctccgcggcggtg
atccgcgcgctggacggcgacatgcagggccgtctgctggcccgccacgaggtgaaaggc
gacagcgacgaaaatcgccgtatcggcgagagcgaacttgcccgctgcgcggcgatgggc
attgaggccggcaaggtgctgcgtctggacgatatggcgcgcagcgataacgtgattttc
tccgccaccggcatcaccaaaggcgatctgctggagggcatcagccgtaaaggcaacatg
gccaccactgaaacgctgctgatccgcggcaaatcccgcaccatccgccgtattcagtcc
atccactatctcgaccgcaaagacccggacgtacagcgccatatcctttga

DBGET integrated database retrieval system