KEGG   Enterobacter lignolyticus SCF1: Entcl_1375Help
Entry
Entcl_1375        CDS       T01342                                 

Definition
(GenBank) 3-oxoacid CoA-transferase, B subunit
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00072  Synthesis and degradation of ketone bodies
esc00280  Valine, leucine and isoleucine degradation
esc00650  Butanoate metabolism
esc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Entcl_1375
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Entcl_1375
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Entcl_1375
Enzymes [BR:esc01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Entcl_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: ADO47640
UniProt: E3GAA4
Position
1450311..1450943
Genome map
AA seq 210 aa AA seqDB search
MAWNREQMAQRAALELQDGFYVNLGIGLPTLVGNHIPDGMEVWLQSENGLLGIGPFPDED
ELDPDLINAGKQTITTLPGSSFFDSAESFAMIRGGRIDLALLGAMQVSARGDLANWMIPG
KMVKGMGGAMDLVAGVKRVVVLMEHCARDGAHKILANCDLPLTGVGVVDRIISDLAVLDI
TSDGLRLVEMAPGVEFEALQAATGCPILRW
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcctggaaccgtgaacaaatggcgcaacgcgccgctctggagctgcaggacggcttc
tatgttaacctggggatcggcttgccgaccctggtgggcaaccatattcctgatggtatg
gaggtctggctgcagagcgaaaacggcctgctcggcatcggccccttccccgacgaagac
gagctggatccggatcttatcaacgccggcaagcagaccatcaccaccttgcccggcagc
agcttcttcgacagcgccgagagcttcgccatgatccgcggcggccgtattgacctggcg
ctgctcggcgcgatgcaggtttcggcgcggggcgatctggcgaactggatgattccgggc
aagatggtcaagggcatgggcggcgccatggatctggtggcgggcgtcaagcgggtggtg
gtgctgatggagcactgcgccagggacggggcgcacaagatcctggcgaactgcgatttg
ccgctgaccggagtcggggtggtggatcgcatcatcagcgatctcgcggtgctggatatc
acctccgatggcctgcgtctggtggagatggctcccggcgtcgagtttgaggcgctgcag
gccgccaccggctgccccatactgcgctggtga

DBGET integrated database retrieval system