KEGG   Enterobacter lignolyticus SCF1: Entcl_1778Help
Entry
Entcl_1778        CDS       T01342                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00860  Porphyrin and chlorophyll metabolism
esc01100  Metabolic pathways
Module
esc_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Entcl_1778
Enzymes [BR:esc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Entcl_1778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase SNO Peptidase_C26 DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ADO48035
UniProt: E3G1Z2
Position
1900345..1901868
Genome map
AA seq 507 aa AA seqDB search
MTQAIMLQGTASDVGKSVLVAGLCRIFYQDGLRTAPFKSQNMALNSGITPDGKEMGRAQI
FQAQAAGITPDVRMNPVLLKPTSDRKAQVVLMGQMATDMDAVSYHEYKPRLRAQILEVYT
SLAQEHDVLVLEGAGSPAEINLRDRDIVNMGMAEMAQCPVILVADIDRGGVFASIYGTLA
LLRDGERARVKGVIINKFRGDVALLYSGIEQIENLTGVPVLGVMPWLDVDLEDEDGVALQ
KGKYRQTAQREIDIAVVQVPHISNFTDFNALAAQPDVRVRYVRYPHELAQADLVILPGSK
NTLGDLVWLRESGMAHAVLQAHRQQVPVMGICGGYQMLGDTIIDEVESGLGTMPGLGMLN
TVTHFAQRKTTTQVSAQMALSLPAWLTQASGVRVQGYEIHMGETQLASGCRPALFLEKDG
ERVADGAISDDGTVLGTYLHGLFDNDAFTRAMVDGLRQRKGLAPLDVAVDYAAYKAQQFD
ILASAMREHIDIQKIYKIMQEHREEGA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggcgattatgttgcagggaacggcgtctgacgtcggtaaaagcgtgctggtg
gcggggctgtgccgtattttttatcaggatggcctgcggaccgcgccgtttaagtcgcag
aatatggcgctcaattccggcatcacgcccgatggcaaagagatggggcgtgcgcagatt
tttcaggcacaggcggcggggattacgccggacgtgcggatgaacccggtgctgttgaaa
ccgaccagcgatcgcaaggcgcaggtggtgctgatggggcagatggcgaccgatatggac
gccgtcagctatcacgagtacaaaccgcgtctgcgcgcacagattctggaggtctatacc
agcctggcgcaggagcacgatgtgctggtgctggaaggggcgggcagcccggcggagatc
aatctgcgcgatcgcgatatcgtcaacatgggcatggccgaaatggcgcagtgcccggtg
atcctcgtggcggatatcgaccggggcggcgtctttgcgtccatctacggcacgctggcg
ctgcttcgcgacggtgaacgggcgcgggtcaaaggggttatcatcaataagtttcgcggc
gatgtggcgctgctgtattccggcattgagcagatcgaaaacctgaccggcgtaccggta
ctgggggtcatgccgtggctggatgtggatctcgaagatgaagacggcgtggcgctgcaa
aagggaaaataccggcaaacagcgcagcgcgagatcgatattgcggtggtgcaggtaccg
catatctccaacttcaccgattttaacgctctggcggcgcagccggatgtccgcgtgcgc
tatgtccgctatccgcatgagctggcgcaggccgacctggttatcctgccgggcagtaaa
aatacgctgggcgacctggtctggctgcgggaaagcggcatggcgcatgccgtgctgcag
gctcatcggcagcaggtgcctgtcatgggaatttgcggcggctatcagatgctcggcgat
accattatcgatgaggtggagtcggggctggggacgatgcccgggctcggcatgctcaat
accgtgacccacttcgcgcagcgcaaaaccacgacccaggtttcggcgcaaatggcgcta
tcgctgcccgcgtggctgacgcaggcttcaggcgtgagggtgcaaggctatgaaattcat
atgggggagacgcagctggcctccggctgtcgcccggcgctgttcctggagaaagacggc
gagcgcgtagcggacggcgccattagcgatgatgggacggtgctagggacgtatcttcac
ggcctgttcgataacgatgctttcacgcgcgcaatggtggacggtttgcgccagcgcaaa
ggattagcgccgctggatgtggcggtagactacgcggcgtataaggctcagcagtttgat
atattagcgagcgccatgagagagcacattgatattcaaaagatttataaaataatgcag
gagcatcgggaggaaggcgcatga

DBGET integrated database retrieval system