KEGG   Enterobacter lignolyticus SCF1: Entcl_2086Help
Entry
Entcl_2086        CDS       T01342                                 

Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00010  Glycolysis / Gluconeogenesis
esc00030  Pentose phosphate pathway
esc00051  Fructose and mannose metabolism
esc00052  Galactose metabolism
esc00680  Methane metabolism
esc01100  Metabolic pathways
esc01110  Biosynthesis of secondary metabolites
esc01120  Microbial metabolism in diverse environments
esc01130  Biosynthesis of antibiotics
esc01200  Carbon metabolism
esc01230  Biosynthesis of amino acids
Module
esc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entcl_2086
   00030 Pentose phosphate pathway
    Entcl_2086
   00051 Fructose and mannose metabolism
    Entcl_2086
   00052 Galactose metabolism
    Entcl_2086
  Energy metabolism
   00680 Methane metabolism
    Entcl_2086
Enzymes [BR:esc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Entcl_2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase DUF2617
Motif
Other DBs
NCBI-ProteinID: ADO48340
UniProt: E3G592
Position
complement(2208312..2209244)
Genome map
AA seq 310 aa AA seqDB search
MTKIYTLTLAPSLDSATQTPQIYPEGKLRCSAPVFEPGGGGINVARAITFLGGAATAIFP
AGGATGEHLVALLAAERVPVEAVETQDWTRQNLHVHVKTSGEQYRFVMPGAALSDDEFAR
LEARVMAADAGAIIVISGSLPPGVSTGRLAEMIKTAQRHGLRCVIDSSGDALAAALSVGG
LELVKPNQKELSALVQRELTQPDDVRQAALELVRSGKAKRVVVSLGPQGALGVDASGSVQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAQNAPLEEMVRYGVAAGSAATLNQGTRLCSLENT
QNIYHYLCQI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagatctatacgctcacgttagcgccctctctcgacagcgctacgcagacccca
caaatttatcccgaaggtaaattacgctgcagcgcccccgtctttgagccgggtggcggc
ggcatcaacgttgcgcgcgctatcacctttcttggcggcgccgcgacggcgattttcccg
gcgggcggcgcaacgggcgagcacctggtcgccctgcttgccgcagagcgcgttccggta
gaagcggtcgaaacacaggactggacgcggcaaaacctgcacgtacatgttaagaccagc
ggcgagcaataccgtttcgtgatgccaggagccgcgctcagcgacgacgaatttgcccgc
ctggaggcccgggtgatggcggccgacgccggcgcgattatcgttattagcggcagcctg
ccgccgggcgtatccacggggcgtctggccgaaatgataaaaaccgcgcagcgacatggc
ctgcgctgcgttatcgacagctccggcgacgcgctggcggccgcgctcagcgtcggcggg
cttgagctggttaagccgaaccagaaggagcttagcgcgctggtccagcgcgagctgacc
cagcccgacgacgtgcgtcaggcagcgcttgaactcgtgcgcagcggcaaagcaaaacgc
gttgtggtatcgcttgggccacagggcgcgctgggcgtggacgccagcggttccgttcag
gtggtgccgccgccggtgaaaagccagagcaccgtcggcgccggggacagcatggtcggc
gccatgacgctgaagctggcgcaaaacgcgccgctggaggagatggtacgctatggcgta
gccgcaggcagcgcggccacgctaaaccagggcactcgcctgtgctcgcttgagaatacg
cagaatatttatcattatctgtgccagatatag

DBGET integrated database retrieval system