KEGG   Enterobacter lignolyticus SCF1: Entcl_2780
Entry
Entcl_2780        CDS       T01342                                 

Definition
(GenBank) aldehyde oxidase and xanthine dehydrogenase molybdopterin binding protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00230  Purine metabolism
esc01100  Metabolic pathways
esc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Entcl_2780
Enzymes [BR:esc01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Entcl_2780
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ADO49028
UniProt: E3GD09
Position
2943580..2945877
AA seq 765 aa
MDELEATATGEPCMRVDAMAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAKQIDSAAA
RALPGVLAIFTWEDVPETPFATAGHAWTLEPEKRDVADRRLLTRHVRHHGDAVAVVVARD
ELTAEKAAHLVNVEWEALPVITTPGAALADGAVAIHEGGNLLKATEILADDPHGAIAAAD
RQFSNHFQTPVIQHCHMEGVTCFAWMEEDKRITIVSSTQIPHIVRRIVGQALGISWSSIR
VIKPHVGGGFGNKQDVLEEPMAAFLTAKLGGIPVKVALSREECFLASRTRHAFTIDARLG
INRDGTLKGYCLDVLSNTGAYASHGHSIASAGGNKIAYLYPRSAFGYRATTCYTNLPSAG
AMRGYGAPQVVFALEALLDDAAAALDLDPVDIRLRNVAREGDKNPVNRKTIFSAGLPECL
RKGRELFDWDKRRADYREQQGNLRHGVGVACFSYSSNTWPVGVEIAGARLLLNQDGCIHV
QSGATEIGQGADTVFTQMVAETVGMPFGMVHVISTQDTDITPFDPGAFASRQSYVAAPAL
REAARQLRDKILQHAAEMLHQSSLNLTIRHGMIEMTERPGVALAAVADVAMDAFYHPERG
GQLSAEASVKTTTNPPAFGCTFVDLTVDVALCKITINRILNVHDSGRILNPLLAEGQVHG
GMGMGIGWSIFEEMIIDETTGLVRNPNLLDYKMPTMMDLPPLESAFVDSCEPQSAYGHKS
LGEPPIIPVAAAIRNAVRMATGVGINTLPLTPKRLFIEFRQAGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggatgagctggaagccaccgccaccggtgaaccctgtatgcgcgtagacgcgatggcc
aaggtcaccgggcgcgcgcgttatacagacgattacgtcatggcaggcatgtgctacgcg
aaatacgttcgcagcccgatagcccacggatacgcaaaacagatagacagcgccgccgcc
cgggcacttcccggcgtgctggcgatttttacctgggaggacgtcccggaaacgccgttt
gccaccgccgggcacgcctggacgctggagccggaaaaacgcgacgtcgccgaccgccgc
ctgttgacccgccacgtccgccaccatggcgatgcggtggctgtcgtggtggcgcgcgat
gagctgaccgccgaaaaagcggcgcacctggtgaacgtggagtgggaggcgctgccggtc
attacgacgcccggcgccgcgctggcggacggcgccgtcgccatccacgaaggcggcaac
ctgctgaaggccaccgaaattctcgccgacgatccgcatggcgcgatcgccgccgccgat
cggcagttcagcaaccactttcagacgccggtcatccagcattgccatatggaaggcgtg
acctgctttgcgtggatggaagaagacaagcgcatcaccattgtctccagcacgcaaatt
ccgcatatcgtacgccgcatcgtcggccaggcgctgggaatctcctggtcctccattcgg
gtgatcaaaccccacgtcggcggcggtttcggcaacaagcaggacgtactggaagagccg
atggcggcatttctcacggccaaactcggcggcatcccggtcaaggtggcgctgagccgc
gaagagtgcttcctcgccagccgcacccgccacgccttcaccatcgacgcccggcttggc
atcaaccgcgacggtacgctgaagggctactgccttgacgtgctgtcgaataccggcgcg
tacgcctcgcacggccactcgatagcctccgcggggggtaacaagattgcctacctttac
ccgcgcagcgccttcggctaccgcgccaccacctgctacaccaacctgccctccgctggc
gccatgcgcggctacggcgcgccgcaggtggtgttcgcgcttgaggcgctgctggatgac
gccgccgccgcgcttgatcttgacccggtcgatatccgcctgcgcaacgtcgcccgggaa
ggcgacaaaaacccggttaatcgcaaaaccatcttcagcgccggtttaccggagtgcctg
cgcaagggccgcgagctgttcgactgggataaacgccgcgccgactaccgcgaacagcag
ggcaacctccgccacggcgtcggcgttgcctgcttcagctacagctcaaatacctggccg
gtcggggtggaaattgcgggcgcccgcctgctgctcaaccaggacggctgtatccacgta
cagagcggcgcgaccgaaatcggccagggcgccgacacggtcttcacccagatggtcgcc
gaaaccgttggcatgccgttcggtatggtgcacgtcatctcgacccaggataccgacatt
acgccgttcgacccgggcgcgtttgcctcccgccagagctatgtcgcggcgcccgcgctg
cgcgaggcggcccgtcagctgcgcgacaagatactccagcacgccgccgaaatgctgcac
cagtcgtcgctgaacctgacgattcgccacggcatgatcgagatgaccgaacgccctggg
gtcgcgctggcggcggttgccgacgtggcgatggatgcgttctaccatccggagcgcggc
ggccagctgtcagcggaagcgtcggtgaaaaccaccaccaacccgcccgccttcggctgc
acctttgtcgacctcaccgtcgacgtggcgctgtgcaaaatcaccatcaaccgcattctg
aacgtccatgactccgggcggatcctcaacccgctgctggcggaaggccaggttcacggc
ggaatgggcatgggcatcggctggtcgattttcgaggagatgatcatcgacgagaccaca
ggactggtgcgtaaccccaacctgctggactacaaaatgccgaccatgatggatctgccg
ccgctggaaagcgcctttgtcgacagctgcgaaccgcagtccgcctatggacataaatcg
ctcggcgagccgccgattattccggtggcggccgctatccgcaatgcggtccgcatggcg
accggggttggcatcaataccctgccgctgacgccgaaacgcctgtttatcgagttccgc
caggcgggattgatttaa

DBGET integrated database retrieval system