KEGG   Enterobacter lignolyticus SCF1: Entcl_2782
Entry
Entcl_2782        CDS       T01342                                 

Definition
(GenBank) (2Fe-2S)-binding domain-containing protein
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00230  Purine metabolism
esc01100  Metabolic pathways
esc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Entcl_2782
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ADO49030
UniProt: E3GD11
Position
2946760..2947251
AA seq 163 aa
MNHASWVTVTCTINGAPYQFTLSPATPLSDLLRTQGLLSVKQGCCVGECGACTVLIDGTA
IDSCLYLAAWIDGKEIRTLEGESVGGELSAVQAAYAKSGAVQCGFCTPGLVMATKALLAK
PHVKPFTVQEIRRGLAGNLCRCTGYQLVVDTVLTLEKEQERND
NT seq 492 nt   +upstreamnt  +downstreamnt
atgaaccacgcatcctgggttaccgtgacctgcaccatcaacggcgcgccttaccagttc
acgctctctcccgcaacgccgctttccgatctgctgcgcacgcaggggctgctgagcgtg
aagcagggctgctgcgttggcgaatgcggcgcctgtacggtgcttattgacggtacggct
atcgacagctgtctctacctcgcggcctggattgacgggaaggagattcgcaccctggaa
ggagagtcggtgggcggtgagctgtcggccgtgcaggcggcctatgcgaaatccggcgcg
gtgcagtgcggcttctgtacgccggggctggtcatggcgacaaaggcgctgctggcgaaa
ccgcacgtgaagccgtttacggtgcaggagatccgacgcgggctggcgggaaatttatgc
cgctgtaccggttatcagctggtggtcgacacggttctcacgctggaaaaggagcaggag
cgcaacgactga

DBGET integrated database retrieval system