KEGG   Enterobacter lignolyticus SCF1: Entcl_3039Help
Entry
Entcl_3039        CDS       T01342                                 

Definition
(GenBank) molybdenum cofactor biosynthesis protein B
  KO
K03638  molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00790  Folate biosynthesis
esc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Entcl_3039
Enzymes [BR:esc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     Entcl_3039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: ADO49285
UniProt: E3G318
Position
complement(3237820..3238332)
Genome map
AA seq 170 aa AA seqDB search
MSQVSAEFIPTRIAVLTVSSRRGEEDDTSGHYLRDVAHEAGHQVVDKAIVKENRYAIRAQ
VSAWIARDDVQVVLINGGTGFTDGDQAPEALLPLFDREIEGFGEVFRMLSFEEIGTSTLQ
SRAVAGVANRTLIFAMPGSTKACRTAWENIIAPQLDARTRPCNFHPHLKK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggtgagcgctgaatttatcccgacccgcattgcggttcttaccgtgtccagc
cgccgcggcgaagaagacgatacctccggccactatctgcgcgatgtggcgcatgaggcc
gggcatcaggtggtcgataaagccatcgtgaaagaaaaccgctacgccattcgcgcgcag
gtttccgcgtggatagcccgcgatgacgttcaggtggtgctgattaacggcggcaccggt
tttaccgacggcgaccaggcgccggaagcgctgctgccgctgttcgatcgcgaaatcgaa
ggtttcggcgaagtgttccggatgctgtcgtttgaagaaattggcacctcgacgctgcag
tcccgcgcggtcgcgggggtggcgaaccgcacgctgattttcgcgatgccgggctcgacc
aaagcctgccgcaccgcctgggaaaatattatcgcgccgcagctcgatgcgcgtacgcgc
ccgtgtaactttcatcctcatttaaagaaataa

DBGET integrated database retrieval system