KEGG   Enterobacter lignolyticus SCF1: Entcl_3099Help
Entry
Entcl_3099        CDS       T01342                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00020  Citrate cycle (TCA cycle)
esc00640  Propanoate metabolism
esc00660  C5-Branched dibasic acid metabolism
esc01100  Metabolic pathways
esc01110  Biosynthesis of secondary metabolites
esc01120  Microbial metabolism in diverse environments
esc01130  Biosynthesis of antibiotics
esc01200  Carbon metabolism
Module
esc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
esc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Entcl_3099
   00640 Propanoate metabolism
    Entcl_3099
   00660 C5-Branched dibasic acid metabolism
    Entcl_3099
Enzymes [BR:esc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Entcl_3099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADO49345
UniProt: E3G3T9
Position
complement(3304797..3305963)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACSTPREAEEAASKIGSGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAEHWLGKRLVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVAIDPLAGPMPYQGRELAFKLGLEGKLVQQFTKI
FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDNVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaataccaggcaaaacagctgtttgcccgctacggtttacctgcgcca
gtcggctatgcctgctccaccccgcgtgaagcagaagaagccgcctctaaaattggttca
ggcccatgggtagttaagtgccaggtgcacgcaggcggccgcggtaaagcgggcggcgtt
aaggtcgttaagagcaaagaagagatccgcgcattcgctgagcactggctgggcaaacgc
ctggtaacctatcaaacagatgctaatggccagccggttaatcagatcctggtagaagcg
gcgaccgatatcgccaaagagctgtaccttggcgccgtcgttgaccgtagctcccgtcgc
gtggtgttcatggcctcgaccgaaggcggcgttgagattgagaaagtggcggaagaaacg
ccgcacctgatccataaagtcgctatcgatccgctggcgggcccaatgccttaccagggt
cgcgagctggcgtttaaactgggtctggaaggtaaactggttcagcagttcaccaagatt
ttcatgggcctggcgaccatcttccttgagcgcgacctggcgctgattgaaatcaacccg
ctggttatcaccaaacagggcgaccttatctgcctcgacggcaaactgggcgctgacggc
aacgcgctgttccgccagccggatctgcgtgaaatgcgcgatcagtctcaggaagacccg
cgcgaagcgcaggctgcgcagtgggaactgaactacgtcgcgctggatggcaacatcggc
tgtatggtgaacggcgcgggcctggcgatgggcaccatggacatcgttaagctgcacggc
ggcgaaccggctaacttcctcgacgtgggcggcggcgcgaccaaagagcgcgtgaccgaa
gcgttcaaaatcatcctctccgatgacaacgtgaaagccgttctggtcaacatcttcggc
ggtatcgtgcgctgcgacctgattgcagacggtatcatcggcgcggttgctgaagtcggc
gttaacgtaccggttgtggttcgtctggaaggcaacaacgccgaactgggcgcgaaaaaa
ctggctgacagcggcctgaatattattgcagcgaaaagtctgacggatgcagctcagcag
gttgttgccgcagtggaggggaaataa

DBGET integrated database retrieval system