KEGG   Enterobacter lignolyticus SCF1: Entcl_3431Help
Entry
Entcl_3431        CDS       T01342                                 

Definition
(GenBank) PsiF repeat-containing protein
Organism
esc  Enterobacter lignolyticus SCF1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PsiF_repeat Peptidase_S49_N Bap31
Motif
Other DBs
NCBI-ProteinID: ADO49676
UniProt: E3G7H6
Position
complement(3660926..3661246)
Genome map
AA seq 106 aa AA seqDB search
MKITLLVTLLFGLVLMTTVGAAEKTLTPQQQKMTLCNEQASSKALKGDARKSFMSECLKK
DSAKAEEKTLTPQQKKMQACNAEAGQKALKGEDRNKFMSTCLKKNG
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataacattactggttacgttactgtttggtctggtgctgatgacgacggtgggg
gccgcggagaaaacgctgacgccccagcagcagaagatgacgctctgcaacgagcaggcg
tcgtctaaagcgttgaagggagacgcaaggaaatcctttatgagcgagtgtctgaagaag
gacagcgcgaaagcagaggaaaaaaccctgacgccgcagcagaaaaaaatgcaggcatgt
aatgccgaagcgggtcagaaagcccttaaaggtgaggatcgcaacaagtttatgagtacc
tgccttaagaaaaacggctag

DBGET integrated database retrieval system