KEGG   Enterobacter lignolyticus SCF1: Entcl_3432Help
Entry
Entcl_3432        CDS       T01342                                 

Definition
(GenBank) major facilitator superfamily MFS_1
  KO
K08161  MFS transporter, DHA1 family, multidrug resistance protein
Organism
esc  Enterobacter lignolyticus SCF1
Brite
KEGG Orthology (KO) [BR:esc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:esc02000]
    Entcl_3432
Transporters [BR:esc02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    Entcl_3432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like MFS_3 MFS_4
Motif
Other DBs
NCBI-ProteinID: ADO49677
UniProt: E3G7H7
Position
complement(3661334..3662536)
Genome map
AA seq 400 aa AA seqDB search
MESWKVNLISVWFGCFFTGLAISQILPFLPLYVSQLGVTSHEALSMWSGLTFSVTFLVSA
IVSPMWGSLADRKGRKLMLLRASLGMAVAILLQAFATNVWQLFFLRAVMGLTSGYIPNAM
ALVASQAPRERSGWALSTLSTAQISGVIGGPLLGGFLADHVGLRAVFFITALLLTVSFLV
TLFLIKEGGRPNVSRGERLSGKAVFASLPYPGLVISLFVTTMVIQMCNGSIGPILALFIK
SMAPDSTNIAFLSGMIAAVPGVSALISAPRLGRLGDRIGAHRILLATLFCAMVMFFAMSF
VTSPLQLGILRFLLGFADGAMLPAVQTLLLKYSSDRVTGRIFGYNQSFMYLGNVAGPLIG
ACVSAMAGFRWVFVATAIVVLINLIQLALMLRKRARVPAR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggaatcctggaaggttaatcttatatccgtctggttcggctgcttttttaccgggctt
gccatcagccaaatcctgccgtttttaccgctctatgtttcgcagctgggcgtaacctca
catgaggccctgtcgatgtggtcggggctgaccttcagcgtgaccttcctggtgtcggcc
atcgtctcgccgatgtggggaagcctcgcggaccgtaaagggcgcaagctgatgctcttg
cgcgcctcgctcggcatggcggtggccattctgctgcaggccttcgccaccaacgtctgg
cagctgtttttcctgcgcgcggtgatggggctgacctccggctatattcctaacgcgatg
gcgctggtggcctcgcaggcgccgcgcgagcgcagcggctgggcgctcagcacgctgtcg
acggcgcaaatcagcggggttatcggcgggccgctgcttggcggtttcctcgccgatcac
gtggggctgcgggcggtgttttttattaccgccctcctgctgacggtgagctttttagtc
accctgtttctgataaaagagggcggcagaccgaacgtgagccgcggtgaacggctgagc
ggtaaggcggttttcgcctcgctgccgtaccccggactggtcattagcctgtttgtcacc
accatggttatccagatgtgcaacgggtcgatagggccgatcctggcgctgtttatcaaa
tcgatggcgccggacagcactaatatcgcctttttaagcggcatgatcgccgcggtgccg
ggcgtgtcggcgctgatctccgctccccgtctgggcaggctcggcgaccggatcggcgcg
caccgcatcctgctggcgacgctgttttgcgccatggtgatgttcttcgccatgtcgttt
gtcacctcgccgctgcagctcggcatcctgcgctttctgctggggtttgccgatggcgcg
atgctgccagcggtacagacgctgctgctcaagtattcgagcgatcgggttaccgggcgc
atctttggctataaccagtcgtttatgtatctcggcaacgtcgccgggccgctgatcggc
gcttgcgtgtcggcgatggccgggtttcgctgggtatttgtcgccacggcgatcgtggtg
ctgataaacctgatccagcttgccctgatgctgcgcaaacgcgcccgggtgcctgcgcgg
tag

DBGET integrated database retrieval system