KEGG   Enterobacter lignolyticus SCF1: Entcl_3445Help
Entry
Entcl_3445        CDS       T01342                                 

Definition
(GenBank) ABC transporter related protein
  KO
K10831  taurine transport system ATP-binding protein [EC:3.6.3.36]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00920  Sulfur metabolism
esc02010  ABC transporters
Module
esc_M00435  Taurine transport system
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Entcl_3445
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Entcl_3445
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:esc02000]
    Entcl_3445
Enzymes [BR:esc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.36  taurine-transporting ATPase
     Entcl_3445
Transporters [BR:esc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Taurine transporter [MD:M00435] [OT]
    Entcl_3445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_22 AAA_16 AAA_28 RsgA_GTPase T2SSE Rad17 SMC_N AAA AAA_30 ATPase_2 AAA_25 SbcCD_C NACHT AAA_29 AAA_33 AAA_5 AAA_23 AAA_14 IstB_IS21
Motif
Other DBs
NCBI-ProteinID: ADO49690
UniProt: E3G7J0
Position
complement(3674485..3675252)
Genome map
AA seq 255 aa AA seqDB search
MLQISHLNARYGGKAVLDDISLSVDRGELLVVLGPSGCGKTTLLNLVAGFIPHASGSITL
NGEPVLGPGASRGVVFQNEGLLPWRTVQDNVAFGLQLAGAGKRERREIARQMLKKVGLDG
AGERFIWQLSGGQRQRVGIARALAADPQLLLLDEPFGALDAFTREQMQTLLLRLWHETGK
QVLLITHDIEEAVFMATELVLLSPGPGRVTERLSLDFARRFVAGEPCRSIKSDPQFIARR
EYVLGRVFEHREAFS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaatatcccacctgaacgcccgctacggcggaaaagcggtgcttgacgatatc
agcctgagcgtcgatcgcggcgaactgctggtggtgctggggccgtccggctgcgggaaa
accacgctgctgaatctggttgccgggtttattcctcacgccagcggcagtattacgctg
aacggcgagccggtgctggggccaggcgcttcacgcggcgtggtgtttcaaaacgaaggg
ttactgccctggcgtacggtgcaggataacgtggcgtttggcctgcagctggcgggcgct
ggaaaacgcgagcgtcgggaaatcgcccggcaaatgctaaaaaaggtcgggctggacggc
gccggagagcgctttatctggcagctttccggtgggcagcgccagcgggtcgggatcgcc
cgggcgctggccgccgatccgcagctcctgctgctcgacgaacccttcggcgcgctggac
gcgtttacccgcgaacagatgcaaaccctgctgctgcgcctgtggcatgaaaccggcaag
caggtgctgttgatcacccacgatatcgaagaggcggtatttatggcgaccgagctggtg
ctgctgtcgccaggccctgggcgggtcaccgagcggctgtcgctggatttcgcccgccgc
tttgtcgccggagagccatgccgcagcattaaatccgatccgcagtttatcgcgcgccgc
gagtacgtcttaggccgcgtatttgaacaccgggaggccttctcatga

DBGET integrated database retrieval system