KEGG   Enterobacter lignolyticus SCF1: Entcl_3455Help
Entry
Entcl_3455        CDS       T01342                                 

Definition
(GenBank) dihydroxyacetone kinase, phosphotransfer subunit
  KO
K05881  phosphoenolpyruvate---glycerone phosphotransferase subunit DhaM [EC:2.7.1.121]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00561  Glycerolipid metabolism
esc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Entcl_3455
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:esc02000]
    Entcl_3455
Enzymes [BR:esc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.121  phosphoenolpyruvate---glycerone phosphotransferase
     Entcl_3455
Transporters [BR:esc02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   EI/HPr/EIIA hybrid protein
    Entcl_3455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIA-man PEP-utilisers_N PTS-HPr PEP-utilizers
Motif
Other DBs
NCBI-ProteinID: ADO49700
UniProt: E3G7K0
Position
complement(3686721..3688151)
Genome map
AA seq 476 aa AA seqDB search
MVNLVIVSHSAQLGQGVGELARQMLMDDGCKIAIAAGIDDPQNPIGTDPIKVMEAIESVA
DADHVLVMMDIGSALLSAETALDLLDPAIAGKVRLCAAPLVEGTLAATVSAASGAGIEKV
IDDAMSALEAKRVQLGLPSLSPAPSSAALPVPDGDAQSLSVVVKNPNGLHVRPASKLVAA
LAGFDADLVLEKDGKCVRPDSINQIALLQVRCNDTLRLLARGPDAHRALAAFDALAASHF
GEEIVPGNDAPAATAQVGSVSGQAWTQVPHLTVPERQSCADPAREQQRLQQAIALTLADL
NALTALAETKFSEDIAAIFSGHHTLLDDPELCDAACEVIRDQQCCAPWAWHQVLSALSQQ
YRELDDPYLQARYIDIDDILHRSLCYLQGTTPPSLADIPPSAILLADDIFPSTVLQLDAG
RVNGICLRAGSALSHGAILARQSEIAWLCEMGAAVDGIRSGEPITLELAARRISRR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacctggtaattgtttctcatagcgcccagctgggccagggcgtcggggaactg
gcccggcagatgttgatggacgatggctgcaagattgccatcgccgcaggcattgacgat
ccgcaaaacccgatcggcaccgatcccatcaaggtcatggaggccatcgagtcggtggcg
gacgccgaccatgtgctggtgatgatggatatcggcagcgcgctgctcagcgctgaaacg
gcgctcgatcttctcgatccggccatcgccggcaaggtgcggctgtgcgccgcgccgctg
gtggagggcacgctggcggctaccgtcagcgccgcctccggcgccggtattgagaaagtg
atcgacgacgcgatgagcgcgctggaggcaaagcgcgtacagctggggttaccatcgctc
tcgccggcaccgtcgtcagcggcgctgccggtgccggatggcgacgcgcagtcgctgagc
gtggtggtgaaaaaccccaatggcctgcacgtgcgtccggcgtcaaagctggtggcggcg
ctggccggttttgacgccgacctggtgctggaaaaggacgggaagtgcgtcaggccggac
agcatcaaccagattgcgctgctacaggtgcgctgcaacgacacgctgcgcctgctggcg
cgcggccccgacgcccaccgggcgctggcggcgtttgacgcgctggcggccagccacttt
ggcgaggagatagtccccggcaacgatgccccggccgcgacggcgcaggttggttctgtc
agcggccaggcgtggactcaggtgccgcatctgacggtgccagagcgccagtcgtgcgcc
gatcctgcccgggagcagcagcgtctgcagcaggccatcgcgctgacgcttgcggatctg
aatgcgctgaccgcgctggcggagacgaaattttcggaggatattgcggcgattttttcc
ggacaccacacgctgctggacgaccccgaactctgtgatgccgcctgtgaggttatccgc
gaccagcagtgctgcgcgccgtgggcctggcaccaggtgctgagcgcgttgagccagcag
tatcgcgagctcgacgatccgtacctgcaggcgcgctacatcgacatcgacgatattctg
catcgctcgctgtgctatttgcaggggacaacgccgccgtcgctggccgatatcccgccg
tcggcgattttgctggcggacgatatctttccctcaacggtactgcagctcgacgccggt
cgggtcaacggtatctgcctgcgggcaggcagcgcgttgtcccacggcgccattctggcg
cgccagtctgagattgcctggctgtgcgagatgggcgctgcggtagacggtatccgcagc
ggcgagccgataacgcttgagctggcggcgcggcgcatttcgcggcgctag

DBGET integrated database retrieval system