KEGG   Enterobacter lignolyticus SCF1: Entcl_3458Help
Entry
Entcl_3458        CDS       T01342                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00561  Glycerolipid metabolism
esc00640  Propanoate metabolism
esc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Entcl_3458
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Entcl_3458
Enzymes [BR:esc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     Entcl_3458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase RibD_C PFK
Motif
Other DBs
NCBI-ProteinID: ADO49703
UniProt: E3G7K3
Position
3690402..3691499
Genome map
AA seq 365 aa AA seqDB search
MLKVIQSPAKYLQGPDASALFGQYAKNLAESFFVIADDFVMKLAGEKVLNGLHEHNIASH
AERFNGECSHVEIKRLMAILEQKGCRGVIGIGGGKTLDTAKAIGYYQKLPVVVVPTIAST
DAPTSALSVIYTEAGEFEEYLIYPKNPDMVVMDTAIIAKAPVRLLVAGMGDALSTWFEAK
ACYDARATSMAGGQSTAAALSLARLCYDTLLAEGEKARLAAEAGVVTDALERIVEANTYL
SGIGFESSGLAAAHAIHNGFTILEECHHLYHGEKVAFGTLAQLVLQNSPLEEIETVLTFC
ENVGLPVTLAQMGVTEDIAAKIQAVAEATCADGETIHNMPFPVNAQSVYAAVLTADRLGQ
RWLAR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagtaattcaatctccggctaagtatcttcaggggccagatgcctccgcgctg
ttcggccagtatgccaaaaatctggcggagagttttttcgtcattgccgacgactttgtg
atgaagctggcgggcgaaaaagtgctgaacggcctgcatgagcacaacatcgccagccat
gccgaacgctttaacggcgaatgcagccatgtggaaattaagcgcctgatggccattctt
gagcaaaaaggctgccgcggcgtgatcggcatcggcggcgggaaaacgctggataccgcc
aaagccatcggctattaccagaagctgccggtggtcgtggtgccgacgattgcctctacc
gatgcgcccaccagcgcgctgtcggtcatttataccgaagccggcgagtttgaagagtac
ctcatctatccgaaaaacccggatatggtggtgatggacacggcgatcatcgccaaagcg
ccggtgcgcctgctggttgccgggatgggcgatgcgctctccacctggtttgaagccaag
gcctgctacgacgcccgcgccaccagcatggcgggcggccagtcaacggcggcggccctg
agcctggcgcgcctgtgctacgacacgctgctggccgaaggggaaaaagcgcggctggcg
gcggaagccggagttgtgaccgatgcgctggagcggatcgttgaagccaatacctacctg
agcggcatcggttttgaaagcagcgggctggcggcggcgcatgctatccataacggattc
acgatccttgaagagtgccaccacctgtatcacggtgagaaagtggcgtttggcacactg
gcccagctggtgctgcagaacagcccgctcgaagagattgaaaccgtgctgacgttctgc
gaaaacgtcgggctgccggtcacgctcgcgcagatgggggttacagaagacattgcagca
aaaattcaggcggtggcggaagcgacctgcgcagacggggaaaccattcacaatatgccg
ttcccggtcaatgcgcagagcgtgtatgccgcagtcctgacggcggaccgtctgggccaa
cgctggctggcgcgctaa

DBGET integrated database retrieval system