KEGG   Enterobacter lignolyticus SCF1: Entcl_3461Help
Entry
Entcl_3461        CDS       T01342                                 

Definition
(GenBank) hypothetical protein
Organism
esc  Enterobacter lignolyticus SCF1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADO49706
UniProt: E3G7K6
Position
complement(3694494..3695441)
Genome map
AA seq 315 aa AA seqDB search
MMFFSRFQAATGGLLFLICGQAMSATSHFQVTTVSMPAWNIITDTLIKMTPLVNGQRDDG
VMSLVCDLARGDKTQQDIDEALLKKNVNLQALAKDNGTLGLLVNSDLTAQQTACSTYLIS
VLFTPVDNSAYMQDVPPAEKADTKNTDAAGKDDKKTKSAADATGKSAVEKVFNQPRFEQD
VRTHIAIAQATAQLYALMAGNLERMKGESWGTYQMRIEQMVREYSPNFLKTVKVFYQAES
TKPIVTRSLTQYGYDISDGSYHQLIRDQHAFLFRSRSVDWLGNGVIMGKRYFVDLNILDT
SAKKDTVVRGGKKGH
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgatgttctttagtcgttttcaggccgcaacgggcggcctgctttttttgatctgcggt
caggcgatgtcggcaaccagtcattttcaggtcaccaccgttagcatgcctgcgtggaat
attatcaccgacacgctgataaaaatgacgcccttagtgaacggccagcgtgatgatggt
gttatgtctttggtctgcgatttagcgcgcggggataaaacgcagcaggatatcgatgag
gcgctgctgaagaaaaatgtgaatctgcaggccctggcaaaggataacggcaccttgggg
ctgttggtcaacagcgatcttaccgcgcagcagaccgcctgctcgacatatctgatctcc
gtattatttacgccggtggataactcagcctatatgcaggacgtgccgccagcggaaaaa
gcggatacgaagaatacggacgcggcgggtaaagatgacaagaagacgaaaagcgcggcg
gacgccacgggaaaaagcgcggtcgagaaagtgttcaaccagccgcgttttgagcaggat
gtcagaacgcacatcgctatcgcgcaggccactgcccagctctatgccctcatggcgggg
aacctggaaaggatgaagggcgagtcatggggaacctatcagatgcgcattgagcagatg
gtcagagagtattcgccaaattttctcaagacggtaaaagtcttttatcaggcggaaagt
accaagccgatcgtcacccgctcgttaactcagtatgggtatgatatttctgacggcagc
taccatcagcttatccgggatcagcatgcctttttgtttcgctccagaagcgtggactgg
ttaggcaacggcgttatcatgggtaaacgctattttgtcgaccttaatattctcgatact
tcggcgaaaaaagataccgttgtgcgtggcggcaaaaagggacactaa

DBGET integrated database retrieval system