KEGG   Enterobacter lignolyticus SCF1: Entcl_3478Help
Entry
Entcl_3478        CDS       T01342                                 

Definition
(GenBank) transcriptional regulator Crl
  KO
K11926  sigma factor-binding protein Crl
Organism
esc  Enterobacter lignolyticus SCF1
Brite
KEGG Orthology (KO) [BR:esc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:esc03000]
    Entcl_3478
Transcription factors [BR:esc03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Entcl_3478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Crl Imm5
Motif
Other DBs
NCBI-ProteinID: ADO49723
UniProt: E3G7M3
Position
complement(3716374..3716775)
Genome map
AA seq 133 aa AA seqDB search
MTLPSGHPKSKLTKKLAALGPYIREEQCEDNRFFFDCLAVCVNVKPAPEKREFWGWWLEM
EAEEKRFTYSYQFGLYDKDGVWQAMVIKDAEVKDRLEQTLRDFHERVRDLLKTFDLALEP
ADDFKGQPVKRSA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgacgttaccgagtggacacccgaagagtaaactgaccaagaaattagcggcccttggc
ccctacattcgtgaggagcagtgcgaggataaccgcttttttttcgactgcctggctgtg
tgcgtcaatgttaaacccgcccctgagaagcgcgagttctggggctggtggctggagatg
gaagcggaagagaaacgtttcacctacagctatcagtttggtttatatgacaaagatggc
gtatggcaggctatggtcatcaaagacgccgaagtgaaagatcgccttgaacaaacgctg
cgggactttcatgaaagggttcgcgatctgctgaaaacgttcgatctggctctggagcca
gcggatgattttaaaggccagccggtaaaacgttccgcctga

DBGET integrated database retrieval system