KEGG   Enterobacter lignolyticus SCF1: Entcl_3483Help
Entry
Entcl_3483        CDS       T01342                                 

Definition
(GenBank) protein of unknown function DUF539
  KO
K05952  uncharacterized protein
Organism
esc  Enterobacter lignolyticus SCF1
Brite
KEGG Orthology (KO) [BR:esc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Entcl_3483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NqrM PetM
Motif
Other DBs
NCBI-ProteinID: ADO49728
UniProt: E3G7M8
Position
complement(3721563..3721766)
Genome map
AA seq 67 aa AA seqDB search
MMTVFLATFAIFVLTILGMSLGYLLKRKSIQGSCGGISSLGLEKVCDCPEPCDARKKRMA
REANRIL
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgatgacggtttttctggcgacgtttgccatttttgtgctgacgatcctcggcatgtcg
ctgggctatctgcttaagcgtaaaagtattcagggaagctgcggggggatctcctccctg
gggcttgagaaagtgtgcgactgtcctgaaccgtgcgacgcgcgtaaaaagcgcatggcg
cgcgaggcgaaccgtattctctga

DBGET integrated database retrieval system