KEGG   Enterobacter lignolyticus SCF1: Entcl_3484Help
Entry
Entcl_3484        CDS       T01342                                 

Definition
(GenBank) NADH:ubiquinone oxidoreductase, subunit F
  KO
K00351  Na+-transporting NADH:ubiquinone oxidoreductase subunit F [EC:1.6.5.8]
Organism
esc  Enterobacter lignolyticus SCF1
Brite
KEGG Orthology (KO) [BR:esc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Entcl_3484
Enzymes [BR:esc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.8  NADH:ubiquinone reductase (Na+-transporting)
     Entcl_3484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 Fer2 FAD_binding_6 NAD_binding_6 HPS3_C FAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ADO49729
UniProt: E3G861
Position
complement(3721769..3722992)
Genome map
AA seq 407 aa AA seqDB search
MEILLGVGMFTLIVLALSVLILFAKSKLVNSGDVVIEINDEADKQIRTPAGDKLLNTLSG
NGIFVSSACGGGGSCGQCRVVVKEGGGDILPTELSHITKREAKEGCRLACQVAVKQNMKI
ELPEEVFGVKKWECEVISNDNKATFIKELKLAIPQGESVPFRAGGYIQIECPPHRVAYAD
FDVPQEYRGDWDKFNLFRFVSEVKEPTLRAYSMANYPEEKGIIMLNVRIATPPPGAPDAP
PGIMSSYIWSLKPGDKVTISGPFGEFFAKETDAEMVFIGGGAGMAPMRSHIFDQLKRLHS
HRKISFWYGARSLREMFYDDEFEQLARENPNFTFHVALSDPQPEDNWTGYTGFIHNVLYN
NYLKDHPAPEDCEFYMCGPPVMNTAVIKMLKDLGVEDDNILLDDFGG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggaaattttactgggcgtaggtatgtttacgctgatcgtgctggccctgtcggtattg
atcctgtttgcaaaatcaaagctggtgaactccggcgatgtggtcattgaaattaacgac
gaggcggataagcagatccgcaccccggcgggcgataagctgcttaacacgctgtccggc
aacgggattttcgtctcttctgcctgcggcggcggcggttcatgcggccagtgccgggtg
gtggtgaaagagggcggcggcgatattctgccgaccgagctttcgcatatcactaagcgc
gaagccaaagagggctgccgcctggcctgccaggtggcggtgaagcagaacatgaagatt
gagctgccggaagaggttttcggcgtgaaaaaatgggagtgcgaggttatctctaacgat
aacaaagccacctttattaaagagctcaagctggcgattccgcagggggagagcgtgcct
ttccgcgccggcggctatattcagatcgaatgtccgcctcaccgggtggcttatgctgat
ttcgacgtgccgcaggagtaccgcggcgactgggacaaattcaacctgttccgctttgtc
tctgaggtaaaagagccgacgcttcgcgcgtactccatggcgaactacccggaagagaag
ggcattatcatgctcaacgtgcgcatcgcaacgccgccgccgggcgcgcctgacgcgcct
ccggggattatgtcgtcgtatatctggtcgcttaagcccggtgataaggtgacgatttcc
gggccgtttggcgagtttttcgccaaagagaccgatgccgaaatggtgtttatcggcggc
ggcgcggggatggcgccgatgcgttcgcatatcttcgatcagcttaagcgtttgcacagc
caccgaaaaatcagcttctggtacggcgcgcgttcgctgcgcgagatgttctacgacgat
gagtttgaacagcttgcccgcgagaacccgaactttaccttccacgtggcgctttccgat
ccgcagccggaagataactggacgggctacacgggctttatccacaacgtgttgtacaac
aactacctgaaggatcatccggcgccggaagactgcgagttttacatgtgcgggccgccg
gtgatgaacaccgcggtcattaagatgcttaaagatctcggcgtcgaggatgacaacatc
ctgctggatgactttggaggctaa

DBGET integrated database retrieval system