KEGG   Enterobacter lignolyticus SCF1: Entcl_3490Help
Entry
Entcl_3490        CDS       T01342                                 

Definition
(GenBank) ErfK/YbiS/YcfS/YnhG family protein
Organism
esc  Enterobacter lignolyticus SCF1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YkuD DUF3756
Motif
Other DBs
NCBI-ProteinID: ADO49735
UniProt: E3G867
Position
3728074..3728814
Genome map
AA seq 246 aa AA seqDB search
MRKIALFIAMLLIPCVSFAGLLSSNSPTTPVSKEFKQQLMGSPVYIQIFKEERTLDLYVK
MGETYQLLDSYKICNYSGGLGPKQRQGDFKSPEGFYSVTREQLKPDSRFYKAINIGFPNA
YDRAHGYEGKYLMIHGACVSIGCYAMTDSGIDEIFQFVTGALVFGQSNVQVSIYPFRMTD
ANMERHKFSFYKDFWSQLKPGYDYFAQTHKPPMVSVVDGRYVVSKPLSSDVVQPQLASNY
TVPEAK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaatcgcattgtttattgcgatgcttttgattccgtgcgtctcatttgcgggc
ctgctcagcagcaacagcccgacaacgccggtcagcaaagaatttaaacagcagttgatg
gggtcgccggtttatatccagatatttaaggaagagcgcacccttgatctgtatgtgaaa
atgggtgaaacctaccagcttctcgacagttacaaaatctgtaactactccggcggcctg
gggcctaagcagcgccagggggacttcaaatcacccgaaggtttctattccgtcacccgc
gaacagctcaaacctgacagccgtttctataaagcgatcaatatcggtttcccgaatgcc
tatgaccgcgcgcacggctacgaagggaaatacctgatgattcacggcgcctgcgtctct
atcggctgctacgccatgaccgattccggcatcgatgagatcttccagttcgtcaccggc
gccctggttttcggccagtccaacgttcaggtgagcatttacccgttccgcatgaccgat
gccaatatggaacgccataagttctcgttttacaaagacttctggtcacagctgaagccc
ggatacgactacttcgcccagacgcataagccgccaatggtgtcggtcgtcgacgggcgc
tacgtggtcagcaagccgttgagcagcgatgtcgtccagccgcagctggcgtcaaactat
acggtccccgaggcaaaataa

DBGET integrated database retrieval system