KEGG   Enterobacter lignolyticus SCF1: Entcl_3495Help
Entry
Entcl_3495        CDS       T01342                                 

Definition
(GenBank) glucose-inhibited division protein A
Organism
esc  Enterobacter lignolyticus SCF1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_oxidored GIDA Pyr_redox_2 Thi4 NAD_binding_8 FAD_binding_3 FAD_binding_2 HI0933_like DAO Pyr_redox Pyr_redox_3 Lycopene_cycl Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ADO49740
UniProt: E3G872
Position
complement(3734346..3735716)
Genome map
AA seq 456 aa AA seqDB search
MDFYLEPARRIPVMATTDVLVVGGGPSGIAAALSAAREGVSTMLIERFGCFGGMMTTAGV
ESIAWWRHENTVESGGLAREIEETARQLGASQPEPQSLSQAINAERFKLVADTMLEDAGV
RRVLHISAVEVIKDGDELQGVITESKSGRQAILAKVIIDCTGDADIAWFAGAPFTKRSKD
DLMCVTTVFSCANVDKQAFMQSIDASRPKYGDWGADEENKNWSYDVHESCREMFSPYLGK
VFAKGKAAGLIPQDVTLGGSWSTITEYGDANYLNVVSIPAVDCTDVFDLTRAEIEGRKQA
MQAIDVLRKFQPGFERAQLKNFGMTVGTRESRHISGRTQLTEQDICQEGRHTDSIGIFPE
FIDGNGRLKLPLEPRYFHIPYGALVPREVENLLVCGRAIDADNFAYATIRNMGCCIVTGE
GAGTAAAIAIKSNTRVSQVDIQLVQARLVRNRVKVF
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggatttttatcttgagccggcccggcgtattccggtcatggcgacaacggatgtcctc
gttgttggcggcggaccttccggtatagcggcagcgttgagcgcagctcgtgaaggggtg
agcacgatgcttatcgaacgtttcggttgttttggcggcatgatgacgacggctggcgtg
gagtctatcgcctggtggcgtcatgagaataccgtcgagtcaggcggtcttgcccgtgaa
atcgaagaaaccgctcgtcagctgggcgcatcgcagcccgagccgcagtcattaagccag
gcgatcaacgctgagcgctttaagctggtggccgacacgatgctggaggacgcgggcgtc
cgtcgcgtattgcacatctctgcggtagaggtcatcaaagatggcgacgagctgcagggg
gtgattaccgaaagcaaatccgggcggcaggccattctggcgaaagtcattattgattgc
accggtgatgccgatatcgcctggtttgcgggagcgccgttcaccaaacgtagcaaggac
gatctgatgtgcgtcactaccgtctttagctgcgccaacgtcgataaacaggctttcatg
caaagcattgatgcgtcgcgtcccaaatacggcgactggggagccgatgaggaaaacaag
aactggtcgtacgatgtccatgaatcctgccgtgaaatgttcagcccatatctcggaaaa
gtttttgcaaaggggaaggcggcaggcctgattccgcaggatgtcaccctgggcggctcc
tggagcaccatcaccgagtatggcgacgccaactatcttaacgtcgtcagcattccggcc
gtcgattgcaccgatgtttttgatttaacccgtgcggaaattgaaggccgtaagcaggca
atgcaggcgatagacgtcctgcgtaaattccagccgggatttgaacgcgcgcagctgaag
aatttcggtatgacggtgggaacgcgggagtcgagacatatttcaggccggacgcagctg
accgaacaggatatttgccaggaggggcgtcatacggattctatcggcattttcccggag
tttatcgacggtaatgggcggttaaagctgccgctggaaccgcgctatttccatattcct
tatggcgcgcttgtgccgcgcgaggttgagaacctgctggtttgcgggcgggcgattgat
gcggacaattttgcctacgccaccatcagaaatatggggtgttgcattgtgacgggcgaa
ggtgccggtaccgctgcggcgattgccatcaagagcaatacgcgagtctcgcaagtggat
attcagcttgtgcaggcgcggctggtgcgaaaccgcgtgaaggtcttttga

DBGET integrated database retrieval system