KEGG   Enterobacter lignolyticus SCF1: Entcl_3497Help
Entry
Entcl_3497        CDS       T01342                                 

Definition
(GenBank) glyoxylate carboligase
  KO
K01608  tartronate-semialdehyde synthase [EC:4.1.1.47]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00630  Glyoxylate and dicarboxylate metabolism
esc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Entcl_3497
Enzymes [BR:esc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.47  tartronate-semialdehyde synthase
     Entcl_3497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ADO49742
UniProt: E3G874
Position
3738334..3740073
Genome map
AA seq 579 aa AA seqDB search
MARMRAIEAAVEILKKEGISVAFGVPGAAINPFYAAMKKSGGIDHVLARHVEGASHMAEG
YTRTRSGNIGVCIGTSGPAGTDMITGLYAASADSIPILCITGQAPVAKLHKEDFQAVDIE
AIATPVTKMACTILESAQLPGIFQKAFWEMRSGRPGPVLLDLPFDVQMAEIEFDIDLYQP
LAPWRPQATVAQAERALAMLNQSAKPVIVAGGGIINAEASELLREFAELTGVPVIQTLRG
WGALPDDHPLMIGRMGCQAGHRYGNASFLASDFVFGIGNRWANRHTGALETYTEGRKFIH
VDIEPAQIGRIFGPDLGIVSDAHAALTLFIQVARDMKARGELKDRSDWAASCAERKRTLL
RRSDFDCTPVKPQRVYHEMNKVFGPETRYISTIGLAQIAANQFLHVYRPRHWINACQAGP
LGWTMPAALGVVKADPSTPVVAISGDYDFQFLIEELAVGAQFNLPYIHVLLNNAYLGLIR
QAQRAFDIDYCVQLSFENINAPEVNGYGVDHKSVVEGLGCKAIRVFEPQDIEPALREAQR
LRDEFRVPVVVEVITERVTNIAMGPDINKVTEFEDIIDL
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggatgcgtgcaattgaggcagccgttgaaatactgaaaaaagaaggcattagc
gttgcctttggcgtgccaggcgcagcaattaacccgttttatgcggcaatgaaaaaatca
ggcggtatcgatcatgtgctggctcgccacgtcgaaggcgcctcgcatatggcggagggc
tatacccggacccgcagcggtaacatcggggtatgcatcggcacctccgggcctgccggc
accgacatgatcaccgggctttatgccgcgtccgcagattctattcctattctctgcatc
accggtcaggctcccgtagccaaactgcacaaagaggatttccaggccgttgatattgag
gccatcgcgacccccgtgaccaaaatggcctgcaccattctcgaatcggcacagctccca
ggcatattccagaaagcgttctgggaaatgcgctctggccgcccgggtccggtcctgctg
gatttaccgttcgatgtgcagatggcggaaatcgaatttgatatcgatctttaccagccg
ctggctccatggcgccctcaggcgacggtcgcccaggctgaacgcgccctggcgatgtta
aatcagtcagcaaaacccgttattgtcgctggtgggggaatcattaacgccgaagccagc
gagctgttacgtgagtttgcagaactgacgggcgtaccggttattcagacgctgcgcggc
tggggcgccctgccggacgatcatccgctgatgattggccgtatgggatgtcaggctggc
catcgttatggcaacgccagtttcctggcctccgattttgtgtttggtatcggcaaccgc
tgggctaaccgccacactggagcactcgaaacctataccgaggggcgcaaattcatccat
gtggatattgagcctgcacagattggccgtatttttggccccgacctcggtattgtttct
gacgcgcatgccgccctcacgctgttcattcaggttgcacgcgacatgaaagcgcgcggc
gagttgaaagatcgcagcgactgggcagccagctgtgccgagcgcaaacgcaccttgctg
cgtcggtctgatttcgactgcacgcctgtcaagccgcagcgggtatatcatgaaatgaat
aaggtctttggccctgaaacccgctatatctcaaccattgggctggcgcagattgccgcc
aaccagttcctgcatgtttaccgcccgcgtcattggatcaacgcctgccaggcaggcccg
ttgggatggacgatgcccgccgcgctcggcgtggtgaaagccgatccgtcaacgcccgtc
gttgcgatctccggggattacgacttccagtttttgattgaagagctggccgtgggcgcg
cagtttaacctgccctatattcatgtcttgctcaacaacgcctacctcgggcttattcgc
caggcacagcgcgctttcgatattgactactgcgttcagctatcgttcgaaaacattaat
gcgccagaggttaacggctacggcgttgatcacaagtcagtagtagaaggtttaggctgt
aaggccattcgcgtttttgaaccgcaggatattgaaccggcgctgcgcgaagcccagcgc
ctgcgtgatgaattccgggtgccggtcgtcgtggaagtcattaccgaacgcgtcaccaat
atcgctatggggccggatattaataaagttaccgagtttgaagatattatcgatctctaa

DBGET integrated database retrieval system